Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  ADP-ALF4 COMPLEX OF S. CEREVISIAE GET3
 
Authors :  A. Mateja, A. Szlachcic, M. E. Downing, M. Dobosz, M. Mariappan, R. S. Hegde, R. J. Keenan
Date :  26 Jul 09  (Deposition) - 11 Aug 09  (Release) - 22 Sep 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.99
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  C,D  (1x)
Biol. Unit 2:  A,B  (1x)
Keywords :  Tail-Anchored, Membrane Protein, Targeting Factor, Endoplasmic Reticulum, Get3, Atpase, Trc40, Atp-Binding, Golgi Apparatus, Er-Golgi Transport, Nucleotide-Binding, Arsenical Resistance, Nucleus, Hydrolase, Cytoplasm, Transport, Arsa, Arsenite (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Mateja, A. Szlachcic, M. E. Downing, M. Dobosz, M. Mariappan, R. S. Hegde, R. J. Keenan
The Structural Basis Of Tail-Anchored Membrane Protein Recognition By Get3.
Nature V. 461 361 2009
PubMed-ID: 19675567  |  Reference-DOI: 10.1038/NATURE08319

(-) Compounds

Molecule 1 - ATPASE GET3
    ChainsA, B, C, D
    EC Number3.6.3.16
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28
    Expression System StrainROSETTA2(DE3)/PLYSS
    Expression System Taxid562
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    SynonymGET3, ARR4, TRC40, ASNA-1, ATPASE SUBUNIT OF THE GET COMPLEX, ARSENICAL PUMP-DRIVING ATPASE, ARSENITE-TRANSLOCATING ATPASE, ARSENICAL RESISTANCE ATPASE, ARSENITE-TRANSPORTING ATPASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)  CD
Biological Unit 2 (1x)AB  

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 14)

Asymmetric Unit (4, 14)
No.NameCountTypeFull Name
1ADP4Ligand/IonADENOSINE-5'-DIPHOSPHATE
2ALF4Ligand/IonTETRAFLUOROALUMINATE ION
3MG4Ligand/IonMAGNESIUM ION
4ZN2Ligand/IonZINC ION
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1ADP2Ligand/IonADENOSINE-5'-DIPHOSPHATE
2ALF2Ligand/IonTETRAFLUOROALUMINATE ION
3MG-1Ligand/IonMAGNESIUM ION
4ZN-1Ligand/IonZINC ION
Biological Unit 2 (2, 4)
No.NameCountTypeFull Name
1ADP2Ligand/IonADENOSINE-5'-DIPHOSPHATE
2ALF2Ligand/IonTETRAFLUOROALUMINATE ION
3MG-1Ligand/IonMAGNESIUM ION
4ZN-1Ligand/IonZINC ION

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLY A:28 , VAL A:29 , GLY A:30 , LYS A:31 , THR A:32 , THR A:33 , ASN A:272 , PRO A:315 , CYS A:317 , GLY A:319 , ILE A:321 , PHE A:330 , ALF A:402 , MG A:403 , HOH A:2066 , HOH A:2118 , HOH A:2131 , HOH A:2132 , HOH A:2133 , HOH A:2134 , LYS B:26 , GLU B:245 , LEU B:247BINDING SITE FOR RESIDUE ADP A 401
02AC2SOFTWAREGLY A:27 , GLY A:28 , LYS A:31 , ASP A:57 , ASN A:61 , PRO A:169 , ADP A:401 , MG A:403 , HOH A:2023 , HOH A:2025 , HOH A:2029 , HOH A:2066 , HOH A:2133 , LYS B:26 , GLY B:27BINDING SITE FOR RESIDUE ALF A 402
03AC3SOFTWARETHR A:32 , ADP A:401 , ALF A:402 , HOH A:2025 , HOH A:2066 , HOH A:2133BINDING SITE FOR RESIDUE MG A 403
04AC4SOFTWARELYS A:26 , GLU A:245 , LEU A:247 , HOH A:2102 , GLY B:28 , VAL B:29 , GLY B:30 , LYS B:31 , THR B:32 , THR B:33 , ASN B:272 , PRO B:315 , LEU B:316 , CYS B:317 , GLY B:319 , GLU B:320 , ILE B:321 , PHE B:330 , ALF B:402 , MG B:403 , HOH B:2078 , HOH B:2137 , HOH B:2142 , HOH B:2154BINDING SITE FOR RESIDUE ADP B 401
05AC5SOFTWARELYS A:26 , GLY A:27 , HOH A:2090 , GLY B:27 , GLY B:28 , LYS B:31 , ASP B:57 , ASN B:61 , PRO B:169 , ADP B:401 , MG B:403 , HOH B:2031 , HOH B:2032 , HOH B:2078 , HOH B:2154BINDING SITE FOR RESIDUE ALF B 402
06AC6SOFTWARETHR B:32 , ADP B:401 , ALF B:402 , HOH B:2031 , HOH B:2078 , HOH B:2154BINDING SITE FOR RESIDUE MG B 403
07AC7SOFTWAREGLY C:28 , VAL C:29 , GLY C:30 , LYS C:31 , THR C:32 , THR C:33 , ASN C:272 , PRO C:315 , LEU C:316 , CYS C:317 , GLY C:319 , ILE C:321 , PHE C:330 , ALF C:402 , MG C:403 , HOH C:2033 , HOH C:2066 , HOH C:2104 , HOH C:2105 , HOH C:2118 , LYS D:26 , GLU D:245 , LEU D:247BINDING SITE FOR RESIDUE ADP C 401
08AC8SOFTWAREGLY C:27 , GLY C:28 , LYS C:31 , ASP C:57 , ASN C:61 , PRO C:169 , ADP C:401 , MG C:403 , HOH C:2026 , HOH C:2027 , HOH C:2033 , HOH C:2034 , HOH C:2066 , LYS D:26 , GLY D:27BINDING SITE FOR RESIDUE ALF C 402
09AC9SOFTWARETHR C:32 , ADP C:401 , ALF C:402 , HOH C:2026 , HOH C:2033 , HOH C:2066BINDING SITE FOR RESIDUE MG C 403
10BC1SOFTWARELYS C:26 , GLU C:245 , LEU C:247 , HOH C:2093 , GLY D:28 , VAL D:29 , GLY D:30 , LYS D:31 , THR D:32 , THR D:33 , ASN D:272 , PRO D:315 , CYS D:317 , GLY D:319 , GLU D:320 , ILE D:321 , PHE D:330 , ALF D:402 , MG D:403 , HOH D:2028 , HOH D:2055 , HOH D:2094 , HOH D:2097BINDING SITE FOR RESIDUE ADP D 401
11BC2SOFTWARELYS C:26 , GLY C:27 , GLY D:27 , GLY D:28 , LYS D:31 , ASP D:57 , ASN D:61 , PRO D:169 , ADP D:401 , MG D:403 , HOH D:2022 , HOH D:2023 , HOH D:2028 , HOH D:2029 , HOH D:2055BINDING SITE FOR RESIDUE ALF D 402
12BC3SOFTWARETHR D:32 , ADP D:401 , ALF D:402 , HOH D:2022 , HOH D:2028 , HOH D:2055BINDING SITE FOR RESIDUE MG D 403
13BC4SOFTWARECYS A:285 , CYS A:288 , CYS B:285 , CYS B:288BINDING SITE FOR RESIDUE ZN A1353
14BC5SOFTWARECYS C:285 , CYS C:288 , CYS D:285 , CYS D:288BINDING SITE FOR RESIDUE ZN C1352

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2WOJ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2WOJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2WOJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2WOJ)

(-) Exons   (0, 0)

(no "Exon" information available for 2WOJ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:301
 aligned with GET3_YEAST | Q12154 from UniProtKB/Swiss-Prot  Length:354

    Alignment length:348
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344        
           GET3_YEAST     5 VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED 352
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhh.....eeee.......hhhhhhhhhhhhhhhh....eeeee.....hhhhhh........ee......eeeee.hhhhhhhhhhh.--------------------....hhhhhh.....hhhhhhhhhhhhhhhhhhh.......eeeee.....hhhhhhhhhhhhhhhhhh.---------------------...hhhhhhhhhhhhhhhhh....eeeeeeee.hhhhhhhhhhhhhhhhhh.....eeeeeee....------hhhhhhhhhhhhhhhhhhhhhh...eeeeee........hhhhhhhhhhhhh........hhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2woj A   5 VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDM--------------------LQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKF---------------------ISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAE------CKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED 352
                                    14        24        34        44        54        64        74        84        94     |   -         -      |124       134       144       154       164       174       184     |   -         -       214       224       234       244       254       264       274   |     -|      294       304       314       324       334       344        
                                                                                                                         100                  121                                                                  190                   212                                                               278    285                                                                   

Chain B from PDB  Type:PROTEIN  Length:301
 aligned with GET3_YEAST | Q12154 from UniProtKB/Swiss-Prot  Length:354

    Alignment length:347
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       
           GET3_YEAST     4 TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL 350
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhh.....eeee.......hhhhhhhhhhhhhhhh....eeeee.....hhhhhh........ee......eeeee.hhhhhhhhhhhhhhhh.--------------------..........hhhhhhhhhhhhhhhhhh-----...eeeee.....hhhhhhhhhhhhhhhhhhh...----------------.....hhhhhhhhhhhhhhhhh....eeeeeeee.hhhhhhhhhhhhhhhhhh...eeeeeeeee.....-----hhhhhhhhhhhhhhhhhhhhhh...eeeeee........hhhhhhhhhhhhh........hhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2woj B   4 TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRA--------------------LADLTGSIPGIDEALSFMEVMKHIKRQE-----TFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEI----------------VDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAEN-----CKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL 350
                                    13        23        33        43        53        63        73        83        93       103 |       -         -  |    133       143       153     | 163       173       183       193         -      |213       223       233       243       253       263       273     |   - |     293       303       313       323       333       343       
                                                                                                                               105                  126                        153   159                               193              210                                                                  279   285                                                                 

Chain C from PDB  Type:PROTEIN  Length:284
 aligned with GET3_YEAST | Q12154 from UniProtKB/Swiss-Prot  Length:354

    Alignment length:347
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       
           GET3_YEAST     5 VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELE 351
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhh.....eeee.......hhhhhhhhhhhhhhhh....eeeee.....hhhhhh........ee......eeeee.hhhhhhhhhh.--------------------------..........hhhhhhhhhhhhhhhh.------...eeeee.....hhhhhhhhhhhhhhhhh------------------------..hhhhhhhhhhhhhhhhh....eeeeeeee.hhhhhhhhhhhhhhhhhh...eeeeeeeee...-------hhhhhhhhhhhhhhhhhhhhhh...eeeeee........hhhhhhhhhhhhh........hhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2woj C   5 VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMND--------------------------LADLTGSIPGIDEALSFMEVMKHIKRQ------TFDTVIFDTAPTGHTLRFLQLPNTLSKLLE------------------------SGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFA-------CKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELE 351
                                    14        24        34        44        54        64        74        84        94    |    -         -         - |     134       144       | -    |  164       174       184   |     -         -       214       224       234       244       254       264       274  |      -|      294       304       314       324       334       344       
                                                                                                                         99                        126                       152    159                          188                      213                                                             277     285                                                                  

Chain D from PDB  Type:PROTEIN  Length:304
 aligned with GET3_YEAST | Q12154 from UniProtKB/Swiss-Prot  Length:354

    Alignment length:348
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344        
           GET3_YEAST     5 VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED 352
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) -------------ArsA_ATPase-2wojD01 D:18-336                                                                                                                                                                                                                                                                                                   ---------------- Pfam domains (1)
           Pfam domains (2) -------------ArsA_ATPase-2wojD02 D:18-336                                                                                                                                                                                                                                                                                                   ---------------- Pfam domains (2)
           Pfam domains (3) -------------ArsA_ATPase-2wojD03 D:18-336                                                                                                                                                                                                                                                                                                   ---------------- Pfam domains (3)
           Pfam domains (4) -------------ArsA_ATPase-2wojD04 D:18-336                                                                                                                                                                                                                                                                                                   ---------------- Pfam domains (4)
         Sec.struct. author ....hhhhhh.....eeee.......hhhhhhhhhhhhhhhh....eeeee.....hhhhhh........ee......eeeee.hhhhhhhhhhhhhhhh-------------.......hhhhhh.....hhhhhhhhhhhhhhhh--------..eeeee.....hhhhhhhhhhhhhhhhhh..--------------------...hhhhhhhhhhhhhhhhh....eeeeeeee.hhhhhhhhhhhhhhhhhh.....eeeeeee.......---hhhhhhhhhhhhhhhhhhhhhh...eeeeee........hhhhhhhhhhhhh........hhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2woj D   5 VEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSR-------------GSLLQGGALADLTGSIPGIDEALSFMEVMKHIKR--------FDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFG--------------------ISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQ---CKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED 352
                                    14        24        34        44        54        64        74        84        94       104         -   |   124       134       144      |  -     | 164       174       184      |  -         -       214       224       234       244       254       264       274      |  -|      294       304       314       324       334       344        
                                                                                                                             104           118                              151      160                            191                  212                                                                  281 285                                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2WOJ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2WOJ)

(-) Pfam Domains  (1, 4)

Asymmetric Unit

(-) Gene Ontology  (24, 24)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (GET3_YEAST | Q12154)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016887    ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
    GO:0005085    guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0051082    unfolded protein binding    Interacting selectively and non-covalently with an unfolded protein.
biological process
    GO:1990507    ATP-independent chaperone mediated protein folding    The process of inhibiting aggregation and assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure that is dependent on interaction with a chaperone, and independent of ATP hydrolysis.
    GO:0000750    pheromone-dependent signal transduction involved in conjugation with cellular fusion    A signal transduction process resulting in the relay, amplification or dampening of a signal generated in response to pheromone exposure in organisms that undergo conjugation with cellular fusion. An example of this process is found in Saccharomyces cerevisiae.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0006620    posttranslational protein targeting to endoplasmic reticulum membrane    The targeting of proteins to a membrane that occurs after their translation. Some secretory proteins exhibit posttranslational transport into the endoplasmic reticulum (ER) lumen: they are synthesized in their entirety on free cytosolic ribosomes and then released into the cytosol, where they are bound by chaperones which keep them in an unfolded state, and subsequently are translocated across the ER membrane.
    GO:0045048    protein insertion into ER membrane    The process that results in incorporation of a protein into an endoplasmic reticulum (ER) membrane. It depends on specific topogenic sequences of amino acids that ensure that a protein acquires the proper orientation during its insertion into the ER membrane.
    GO:0046685    response to arsenic-containing substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an arsenic stimulus from compounds containing arsenic, including arsenates, arsenites, and arsenides.
    GO:0009408    response to heat    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism.
    GO:0010038    response to metal ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
    GO:0006890    retrograde vesicle-mediated transport, Golgi to ER    The directed movement of substances from the Golgi back to the endoplasmic reticulum, mediated by vesicles bearing specific protein coats such as COPI or COG.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0016192    vesicle-mediated transport    A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
cellular component
    GO:0043529    GET complex    A multisubunit complex involved in ER/Golgi trafficking (Golgi to ER Traffic). In yeast, includes Get1p, Get2p and Get3p proteins.
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ADP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ALF  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2woj)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2woj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GET3_YEAST | Q12154
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.6.3.16
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GET3_YEAST | Q12154
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GET3_YEAST | Q121543a36 3a37 3b2e 3h84 3idq 3sja 3sjb 3sjc 3sjd 3vlc 3zs8 3zs9 4pwx 4xtr 4xvu 4xwo 5bw8 5bwk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2WOJ)