Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF EAS D15 TRUNCATION MUTANT
 
Authors :  A. H. Kwan
Date :  07 Jul 08  (Deposition) - 19 Aug 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Hydrophobin, Eas, Rodlets, Assembly, Amyloid, Cell Wall, Cell Wall Biogenesis/Degradation, Secreted, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. H. Kwan, I. Macindoe, P. V. Vukasin, V. K. Morris, I. Kass, R. Gupte, A. E. Mark, M. D. Templeton, J. P. Mackay, M. Sunde
The Cys3-Cys4 Loop Of The Hydrophobin Eas Is Not Required For Rodlet Formation And Surface Activity.
J. Mol. Biol. V. 382 708 2008
PubMed-ID: 18674544  |  Reference-DOI: 10.1016/J.JMB.2008.07.034
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYDROPHOBIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PHUE
    Expression System Strain: BL21
    Expression System Vector Type: PLASMID
    Gene: EAS, BLI-7, CCG-2
    Organism Scientific: NEUROSPORA CRASSA
    Organism Taxid: 5141
    Synonym: RODLET PROTEIN, CLOCK-CONTROLLED GENE PROTEIN 2, BLUE LIGHT-INDUCED PROTEIN 7

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2K6A)

(-) Sites  (0, 0)

(no "Site" information available for 2K6A)

(-) SS Bonds  (4, 4)

NMR Structure
No.Residues
1A:10 -A:46
2A:19 -A:40
3A:20 -A:31
4A:47 -A:66

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2K6A)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2K6A)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HYDROPHOBINPS00956 Fungal hydrophobins signature.RODL_NEUCR77-88  1A:37-48

(-) Exons   (0, 0)

(no "Exon" information available for 2K6A)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:68
 aligned with RODL_NEUCR | Q04571 from UniProtKB/Swiss-Prot  Length:108

    Alignment length:83
                                    35        45        55        65        75        85        95       105   
           RODL_NEUCR    26 RATTIGPNTCSIDDYKPYCCQSMSGPAGSPGLLNLIPVDLSASLGCVVGVIGSQCGASVKCCKDDVTNTGNSFLIINAANCVA 108
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..........eeeeeee...---------------...eeeee....eee..eeeee...........eee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------HYDROPHOBIN -------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                 2k6a A   1 SATTIGPNTCSIDDYKPYCCQSMSG---------------SASLGCVVGVIGSQCGASVKCCKDDVTNTGNSFLIINAANCVA  68
                                    10        20    |    -         -|       35        45        55        65   
                                                   25              26
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2K6A)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2K6A)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2K6A)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (RODL_NEUCR | Q04571)
molecular function
    GO:0005199    structural constituent of cell wall    The action of a molecule that contributes to the structural integrity of a cell wall.
biological process
    GO:0071555    cell wall organization    A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
cellular component
    GO:0005618    cell wall    The rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal, most prokaryotic cells and some protozoan parasites, maintaining their shape and protecting them from osmotic lysis. In plants it is made of cellulose and, often, lignin; in fungi it is composed largely of polysaccharides; in bacteria it is composed of peptidoglycan; in protozoan parasites such as Giardia species, it's made of carbohydrates and proteins.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0009277    fungal-type cell wall    A rigid yet dynamic structure surrounding the plasma membrane that affords protection from stresses and contributes to cell morphogenesis, consisting of extensively cross-linked glycoproteins and carbohydrates. The glycoproteins may be modified with N- or O-linked carbohydrates, or glycosylphosphatidylinositol (GPI) anchors; the polysaccharides are primarily branched glucans, including beta-linked and alpha-linked glucans, and may also include chitin and other carbohydrate polymers, but not cellulose or pectin. Enzymes involved in cell wall biosynthesis are also found in the cell wall. Note that some forms of fungi develop a capsule outside of the cell wall under certain circumstances; this is considered a separate structure.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2k6a)
 
  Sites
(no "Sites" information available for 2k6a)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2k6a)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2k6a
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RODL_NEUCR | Q04571
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RODL_NEUCR | Q04571
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RODL_NEUCR | Q04571: 2fmc 2lfn 4bwh

(-) Related Entries Specified in the PDB File

2fmc SOLUTION STRUCTURE OF THE CLASS I HYDROPHOBIN EAS