|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (8, 8)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 6EBX) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 6EBX) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 6EBX) |
Exons (0, 0)| (no "Exon" information available for 6EBX) |
Sequences/Alignments
Asymmetric/Biological Unit
Chain A from PDB Type:PROTEIN Length:62
SCOP domains d6ebxa_ A: Erabutoxin B (also neurotoxin B) SCOP domains
CATH domains 6ebxA00 A:1-62 CD59 CATH domains
Pfam domains -------------------------------------------------------------- Pfam domains
SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
PROSITE -------------------------------------------------------------- PROSITE
Transcript -------------------------------------------------------------- Transcript
6ebx A 1 RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN 62
10 20 30 40 50 60
Chain B from PDB Type:PROTEIN Length:62
SCOP domains d6ebxb_ B: Erabutoxin B (also neurotoxin B) SCOP domains
CATH domains 6ebxB00 B:1-62 CD59 CATH domains
Pfam domains -------------------------------------------------------------- Pfam domains
SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
PROSITE -------------------------------------------------------------- PROSITE
Transcript -------------------------------------------------------------- Transcript
6ebx B 1 RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN 62
10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 6EBX) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) |
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|