Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CHICKEN CITRATE SYNTHASE COMPLEX WITH TRIFLUOROACETONYL-COA AND CITRATE
 
Authors :  K. C. Usher, S. J. Remington
Date :  19 Jun 97  (Deposition) - 24 Dec 97  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.25
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Oxo-Acid-Lyase, Tricarboxylic Acid Cycle, Allosteric Enzyme (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. C. Usher, B. Branchaud, S. J. Remington
Trifluoroacetonyl Coenzyme A, An Inhibitor Of Citrate Synthase, Binds In A Combination Of Productive And Nonproductive Modes
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CITRATE SYNTHASE
    Cellular Location: INNER MATRIX
    Chains: A, B
    EC Number: 4.1.3.7
    Organ: HEART
    Organelle: MITOCHONDRIA
    Organism Common: CHICKEN
    Organism Scientific: GALLUS GALLUS
    Organism Taxid: 9031
    Tissue: MUSCLE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1CIT2Ligand/IonCITRIC ACID
2COF2Ligand/IonTRIFLUOROACETONYL COENZYME A

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:46 , PRO A:272 , LEU A:273 , HIS A:274 , ALA A:277 , GLU A:280 , TRP A:284 , ARG A:313 , VAL A:314 , VAL A:315 , PRO A:316 , GLY A:317 , TYR A:318 , GLY A:319 , HIS A:320 , ALA A:321 , LYS A:366 , ALA A:367 , LYS A:368 , ASN A:373 , ASP A:375 , CIT A:701 , HOH A:703 , HOH A:727 , HOH A:734 , HOH A:751 , HOH A:764 , TYR B:158 , ARG B:164 , LEU B:419BINDING SITE FOR RESIDUE COF A 700
2AC2SOFTWAREHIS A:238 , ASN A:242 , HIS A:274 , HIS A:320 , ARG A:329 , ASP A:375 , ARG A:401 , COF A:700 , HOH A:751 , ARG B:421BINDING SITE FOR RESIDUE CIT A 701
3AC3SOFTWARETYR A:158 , ARG A:164 , LEU A:419 , ARG B:46 , PRO B:272 , LEU B:273 , HIS B:274 , ALA B:277 , ARG B:313 , VAL B:314 , VAL B:315 , PRO B:316 , GLY B:317 , TYR B:318 , GLY B:319 , HIS B:320 , ALA B:321 , LYS B:366 , ALA B:367 , LYS B:368 , ASN B:373 , ASP B:375 , CIT B:701 , HOH B:738 , HOH B:745 , HOH B:773BINDING SITE FOR RESIDUE COF B 700
4AC4SOFTWAREARG A:421 , HIS B:238 , ASN B:242 , HIS B:274 , HIS B:320 , ARG B:329 , ASP B:375 , ARG B:401 , COF B:700 , HOH B:762BINDING SITE FOR RESIDUE CIT B 701
5ACAUNKNOWNHIS A:274 , HIS A:320 , ASP A:375ENZYME ACTIVE SITE.
6ACBUNKNOWNHIS B:274 , HIS B:320 , ASP B:375ENZYME ACTIVE SITE.

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 6CSC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 6CSC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 6CSC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 6CSC)

(-) Exons   (0, 0)

(no "Exon" information available for 6CSC)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:437
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains d6csca_ A: Citrate synthase                                                                                                                                                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains --6cscA01 A:3-276,A:392-423 Citrate Synthase, domain 1                                                                                                                                                                                                                              6cscA02 A:277-391 Cytochrome P450-Terp, domain 2                                                                   6cscA01 A:3-276,A:392-423       -------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhh.........hhhhh..............eee...eee.....hhhhhhh...........hhhhhhhhhh.....hhhhhhhhhhhhh.....hhhhhhhhh......hhhhhhhhhhhhhhh.hhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhh....hhhhhhhhhhhhh........hhhhhhhhhhhh...hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhh.................hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh.........hhh.hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 6csc A   1 ASSTNLKDVLASLIPKEQARIKTFRQQHGNTAVGQITVDMSYGGMRGMKGLIYETSVLDPDEGIRFRGFSIPECQKLLPKAGGGEEPLPEGLFWLLVTGQIPTPEQVSWVSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGINRTKYWEFVYEDAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDPQFTELMRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLLWLSQLQKDLGADASDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPSDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTAGLEKLSAGG 437
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       


Chain B from PDB  Type:PROTEIN  Length:434
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains d6cscb_ B: Citrate synthase                                                                                                                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 6cscB01 B:4-276,B:392-423 Citrate Synthase, domain 1                                                                                                                                                                                                                             6cscB02 B:277-391 Cytochrome P450-Terp, domain 2                                                                   6cscB01 B:4-276,B:392-423       -------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhh.........hhhhh.............eeee...eeee....hhhhhhh...........hhhhhhhhhh.....hhhhhhhhhhhhhh....hhhhhhhhh......hhhhhhhhhhhhhhh.hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhh....hhhhhhhhhhhhh........hhhhhhhhhhhh...hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..................hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 6csc B   4 TNLKDVLASLIPKEQARIKTFRQQHGNTAVGQITVDMSYGGMRGMKGLIYETSVLDPDEGIRFRGFSIPECQKLLPKAGGGEEPLPEGLFWLLVTGQIPTPEQVSWVSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGINRTKYWEFVYEDAMDLIAKLPCVAAKIYRNLYRAGSSIGAIDSKLDWSHNFTNMLGYTDPQFTELMRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLLWLSQLQKDLGADASDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPSDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTAGLEKLSAGG 437
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 6CSC)

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CIT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    COF  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    ACA  [ RasMol ]  +environment [ RasMol ]
    ACB  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 6csc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  6csc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CISY_CHICK | P23007
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.1.3.7
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CISY_CHICK | P23007
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CISY_CHICK | P23007: 1al6 1amz 1csc 1csh 1csi 1csr 1css 2csc 3csc 4csc 5csc 5cts 6cts

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 6CSC)