Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CBLC (MMACHC) (1-238), A HUMAN B12 PROCESSING ENZYME, COMPLEXED WITH AN ANTIVITAMIN B12
 
Authors :  A. Shanmuganathan, A. Karasik, M. Ruetz, R. Banerjee, B. Krautler, M. K
Date :  01 Feb 17  (Deposition) - 07 Jun 17  (Release) - 21 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.51
Chains :  Asym./Biol. Unit :  A
Keywords :  Vitamin B12, Oxidoreductase, B12 Trafficking, B12 Processing, B12 Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Ruetz, A. Shanmuganathan, C. Gherasim, A. Karasik, R. Salchner, C. Kieninger, K. Wurst, R. Banerjee, M. Koutmos, B. Krautler
Antivitamin B12 Inhibition Of The Human B12 -Processing Enzyme Cblc: Crystal Structure Of An Inactive Ternary Complex With Glutathione As The Cosubstrate.
Angew. Chem. Int. Ed. Engl. V. 56 7387 2017
PubMed-ID: 28544088  |  Reference-DOI: 10.1002/ANIE.201701583

(-) Compounds

Molecule 1 - METHYLMALONIC ACIDURIA AND HOMOCYSTINURIA TYPE C PROTEIN
    Chains: A
    EC Number: 1.16.1.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: MMACHC
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CBLC,CYANOCOBALAMIN REDUCTASE (CYANIDE-ELIMINATING)

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 7)

Asymmetric/Biological Unit (6, 7)
No.NameCountTypeFull Name
11711Ligand/Ion2-PHENYLAMINO-ETHANESULFONIC ACID
28FS1Ligand/Ion1-ETHYNYL-2,4-DIFLUOROBENZENE
3B121Ligand/IonCOBALAMIN
4GSH1Ligand/IonGLUTATHIONE
5NA1Ligand/IonSODIUM ION
6SO42Ligand/IonSULFATE ION

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:34 , LEU A:35 , PRO A:36 , ASP A:104 , ILE A:115 , ALA A:117 , GLN A:118 , HIS A:122 , TYR A:129 , GLN A:131 , ARG A:144 , SER A:146 , VAL A:148 , CYS A:149 , ILE A:160 , PHE A:196 , TRP A:200 , 8FS A:302 , HOH A:403 , HOH A:405 , HOH A:418 , HOH A:424binding site for residue B12 A 301
2AC2SOFTWAREB12 A:301 , GSH A:303binding site for residue 8FS A 302
3AC3SOFTWAREASP A:77 , PRO A:78 , VAL A:79 , ASP A:80 , PHE A:158 , ARG A:161 , ARG A:206 , TYR A:215 , PHE A:223 , ARG A:230 , 8FS A:302 , HOH A:412binding site for residue GSH A 303
4AC4SOFTWAREALA A:84 , ARG A:91 , GLU A:100 , ILE A:101 , GLU A:106 , NA A:307binding site for residue 171 A 304
5AC5SOFTWAREGLU A:136 , ALA A:137 , ASP A:138binding site for residue SO4 A 305
6AC6SOFTWAREALA A:137 , PRO A:139 , ARG A:186binding site for residue SO4 A 306
7AC7SOFTWAREARG A:91 , 171 A:304binding site for residue NA A 307

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5UOS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5UOS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5UOS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5UOS)

(-) Exons   (0, 0)

(no "Exon" information available for 5UOS)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:239
                                                                                                                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhh...eeeeeeehhhhhh.............eeeeeeee..hhhhhhhhhhhhh.hhhhh.hhhhhhhhhhhhhhhhhh.....eeee............hhhhhhhhh...eeehhhhh............eee........eeeeeeeeeeee..............hhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5uos A  -2 SNAMEPKVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPLPGPTLAFLVLSTPAMFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGL 236
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5UOS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5UOS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5UOS)

(-) Gene Ontology  (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    171  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    8FS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    B12  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GSH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5uos)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5uos
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MMAC_HUMAN | Q9Y4U1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.16.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MMAC_HUMAN | Q9Y4U1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MMAC_HUMAN | Q9Y4U1: 3sby 3sbz 3sc0 3som

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5UOS)