3SC0 - JenaLib

Title :   CRYSTAL STRUCTURE OF MMACHC (1-238), A HUMAN B12 PROCESSING ENZYME, COMPLEXED WITH METHYLCOBALAMIN

Authors :   M. Koutmos, C. Gherasim, J. L. Smith, R. Banerjee

Date :   06 Jun 11 (Deposition) - 22 Jun 11 (Release) - 25 Apr 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.95

Chains :   Asym. Unit : A
Biol. Unit 1: A  (1x)
Biol. Unit 2: A  (2x)

Keywords :   Mmachc, Cblc, Cobalamin, Flavin, Glutathione, Flavin Reductase, Oxidoreductase, Maturase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Koutmos, C. Gherasim, J. L. Smith, R. Banerjee
Structural Basis Of Multifunctionality In A Vitamin B12-Processing Enzyme.
J. Biol. Chem. V. 286 29780 2011
PubMed-ID: 21697092 | Reference-DOI: 10.1074/JBC.M111.261370

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (14, 14)

Asymmetric Unit (14, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_024770	Q	27	R	MMAC_HUMAN	Disease (MMAHCC)	546099787	A	Q	27	R
02	UniProt	VAR_024771	L	116	P	MMAC_HUMAN	Disease (MMAHCC)	121918240	A	L	116	P
03	UniProt	VAR_024772	H	122	R	MMAC_HUMAN	Disease (MMAHCC)	---	A	H	122	R
04	UniProt	VAR_024773	Y	130	H	MMAC_HUMAN	Disease (MMAHCC)	372670428	A	Y	130	H
05	UniProt	VAR_024774	G	147	A	MMAC_HUMAN	Disease (MMAHCC)	140522266	A	G	147	A
06	UniProt	VAR_024775	G	147	D	MMAC_HUMAN	Disease (MMAHCC)	140522266	A	G	147	D
07	UniProt	VAR_024776	G	156	D	MMAC_HUMAN	Disease (MMAHCC)	---	A	G	156	D
08	UniProt	VAR_024777	W	157	C	MMAC_HUMAN	Disease (MMAHCC)	---	A	W	157	C
09	UniProt	VAR_024778	R	161	G	MMAC_HUMAN	Disease (MMAHCC)	---	A	R	161	G
10	UniProt	VAR_024779	R	161	Q	MMAC_HUMAN	Disease (MMAHCC)	121918243	A	R	161	Q
11	UniProt	VAR_024780	R	189	S	MMAC_HUMAN	Disease (MMAHCC)	200895671	A	R	189	S
12	UniProt	VAR_024781	L	193	P	MMAC_HUMAN	Disease (MMAHCC)	---	A	L	193	P
13	UniProt	VAR_024782	R	206	P	MMAC_HUMAN	Disease (MMAHCC)	---	A	R	206	P
14	UniProt	VAR_024783	R	206	W	MMAC_HUMAN	Disease (MMAHCC)	---	A	R	206	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (14, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_024770	Q	27	R	MMAC_HUMAN	Disease (MMAHCC)	546099787	A	Q	27	R
02	UniProt	VAR_024771	L	116	P	MMAC_HUMAN	Disease (MMAHCC)	121918240	A	L	116	P
03	UniProt	VAR_024772	H	122	R	MMAC_HUMAN	Disease (MMAHCC)	---	A	H	122	R
04	UniProt	VAR_024773	Y	130	H	MMAC_HUMAN	Disease (MMAHCC)	372670428	A	Y	130	H
05	UniProt	VAR_024774	G	147	A	MMAC_HUMAN	Disease (MMAHCC)	140522266	A	G	147	A
06	UniProt	VAR_024775	G	147	D	MMAC_HUMAN	Disease (MMAHCC)	140522266	A	G	147	D
07	UniProt	VAR_024776	G	156	D	MMAC_HUMAN	Disease (MMAHCC)	---	A	G	156	D
08	UniProt	VAR_024777	W	157	C	MMAC_HUMAN	Disease (MMAHCC)	---	A	W	157	C
09	UniProt	VAR_024778	R	161	G	MMAC_HUMAN	Disease (MMAHCC)	---	A	R	161	G
10	UniProt	VAR_024779	R	161	Q	MMAC_HUMAN	Disease (MMAHCC)	121918243	A	R	161	Q
11	UniProt	VAR_024780	R	189	S	MMAC_HUMAN	Disease (MMAHCC)	200895671	A	R	189	S
12	UniProt	VAR_024781	L	193	P	MMAC_HUMAN	Disease (MMAHCC)	---	A	L	193	P
13	UniProt	VAR_024782	R	206	P	MMAC_HUMAN	Disease (MMAHCC)	---	A	R	206	P
14	UniProt	VAR_024783	R	206	W	MMAC_HUMAN	Disease (MMAHCC)	---	A	R	206	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (14, 28)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_024770	Q	27	R	MMAC_HUMAN	Disease (MMAHCC)	546099787	A	Q	27	R
02	UniProt	VAR_024771	L	116	P	MMAC_HUMAN	Disease (MMAHCC)	121918240	A	L	116	P
03	UniProt	VAR_024772	H	122	R	MMAC_HUMAN	Disease (MMAHCC)	---	A	H	122	R
04	UniProt	VAR_024773	Y	130	H	MMAC_HUMAN	Disease (MMAHCC)	372670428	A	Y	130	H
05	UniProt	VAR_024774	G	147	A	MMAC_HUMAN	Disease (MMAHCC)	140522266	A	G	147	A
06	UniProt	VAR_024775	G	147	D	MMAC_HUMAN	Disease (MMAHCC)	140522266	A	G	147	D
07	UniProt	VAR_024776	G	156	D	MMAC_HUMAN	Disease (MMAHCC)	---	A	G	156	D
08	UniProt	VAR_024777	W	157	C	MMAC_HUMAN	Disease (MMAHCC)	---	A	W	157	C
09	UniProt	VAR_024778	R	161	G	MMAC_HUMAN	Disease (MMAHCC)	---	A	R	161	G
10	UniProt	VAR_024779	R	161	Q	MMAC_HUMAN	Disease (MMAHCC)	121918243	A	R	161	Q
11	UniProt	VAR_024780	R	189	S	MMAC_HUMAN	Disease (MMAHCC)	200895671	A	R	189	S
12	UniProt	VAR_024781	L	193	P	MMAC_HUMAN	Disease (MMAHCC)	---	A	L	193	P
13	UniProt	VAR_024782	R	206	P	MMAC_HUMAN	Disease (MMAHCC)	---	A	R	206	P
14	UniProt	VAR_024783	R	206	W	MMAC_HUMAN	Disease (MMAHCC)	---	A	R	206	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:237
 aligned with MMAC_HUMAN | Q9Y4U1 from UniProtKB/Swiss-Prot  Length:282

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           MMAC_HUMAN     2 EPKVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPLPGPTLAFLVLSTPAMFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQ 238
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhh......eeeeeeee..hhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.....eeee............hhhhhhhhh...eeehhhhh............eee........eeeeeeeeeeee..............hhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhh........ Sec.struct. author
             SAPs(SNPs) (1) -------------------------R----------------------------------------------------------------------------------------P-----R-------H----------------A--------DC---G---------------------------S---P------------P-------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------------------------------------------------D-------------Q--------------------------------------------W-------------------------------- SAPs(SNPs) (2)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3sc0 A   2 EPKVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPLPGPTLAFLVLSTPAMFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQ 238
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Asymmetric Unit(hide GO term definitions)

Chain A (MMAC_HUMAN | Q9Y4U1)

molecular function
	GO:0031419	cobalamin binding	Interacting selectively and non-covalently with cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
	GO:0033787	cyanocobalamin reductase (cyanide-eliminating) activity	Catalysis of the reaction: cob(I)alamin + hydrogen cyanide + NADP(+) = cyanocob(III)alamin + H(+) + NADPH.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0009236	cobalamin biosynthetic process	The chemical reactions and pathways resulting in the formation of cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
	GO:0009235	cobalamin metabolic process	The chemical reactions and pathways involving cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		COB	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3sc0)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3sc0
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MMAC_HUMAN \| Q9Y4U1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	277400
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description