Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MMACHC (1-238), A HUMAN B12 PROCESSING ENZYME, COMPLEXED WITH METHYLCOBALAMIN
 
Authors :  M. Koutmos, C. Gherasim, J. L. Smith, R. Banerjee
Date :  06 Jun 11  (Deposition) - 22 Jun 11  (Release) - 25 Apr 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.95
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (2x)
Keywords :  Mmachc, Cblc, Cobalamin, Flavin, Glutathione, Flavin Reductase, Oxidoreductase, Maturase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Koutmos, C. Gherasim, J. L. Smith, R. Banerjee
Structural Basis Of Multifunctionality In A Vitamin B12-Processing Enzyme.
J. Biol. Chem. V. 286 29780 2011
PubMed-ID: 21697092  |  Reference-DOI: 10.1074/JBC.M111.261370

(-) Compounds

Molecule 1 - METHYLMALONIC ACIDURIA AND HOMOCYSTINURIA TYPE C PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMCSG7
    Expression System Strain: BL21
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: B12 BINDING DOMAIN, RESIDUES 1-238
    Gene: MMACHC
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (1x): A
Biological Unit 2 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1COB1Ligand/IonCO-METHYLCOBALAMIN
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1COB1Ligand/IonCO-METHYLCOBALAMIN
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1COB2Ligand/IonCO-METHYLCOBALAMIN

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:34 , LEU A:35 , PRO A:36 , ASP A:104 , PRO A:113 , ILE A:115 , ALA A:117 , GLN A:118 , THR A:119 , HIS A:122 , TYR A:129 , GLN A:131 , GLN A:133 , SER A:146 , VAL A:148 , CYS A:149 , ALA A:159 , ILE A:160 , PHE A:196 , TRP A:200 , HOH A:242 , HOH A:246 , HOH A:247 , HOH A:248 , HOH A:294 , HOH A:349 , HOH A:355 , HOH A:390BINDING SITE FOR RESIDUE COB A 300

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3SC0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3SC0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (14, 14)

Asymmetric Unit (14, 14)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_024770Q27RMMAC_HUMANDisease (MMAHCC)546099787AQ27R
02UniProtVAR_024771L116PMMAC_HUMANDisease (MMAHCC)121918240AL116P
03UniProtVAR_024772H122RMMAC_HUMANDisease (MMAHCC)  ---AH122R
04UniProtVAR_024773Y130HMMAC_HUMANDisease (MMAHCC)372670428AY130H
05UniProtVAR_024774G147AMMAC_HUMANDisease (MMAHCC)140522266AG147A
06UniProtVAR_024775G147DMMAC_HUMANDisease (MMAHCC)140522266AG147D
07UniProtVAR_024776G156DMMAC_HUMANDisease (MMAHCC)  ---AG156D
08UniProtVAR_024777W157CMMAC_HUMANDisease (MMAHCC)  ---AW157C
09UniProtVAR_024778R161GMMAC_HUMANDisease (MMAHCC)  ---AR161G
10UniProtVAR_024779R161QMMAC_HUMANDisease (MMAHCC)121918243AR161Q
11UniProtVAR_024780R189SMMAC_HUMANDisease (MMAHCC)200895671AR189S
12UniProtVAR_024781L193PMMAC_HUMANDisease (MMAHCC)  ---AL193P
13UniProtVAR_024782R206PMMAC_HUMANDisease (MMAHCC)  ---AR206P
14UniProtVAR_024783R206WMMAC_HUMANDisease (MMAHCC)  ---AR206W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (14, 14)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_024770Q27RMMAC_HUMANDisease (MMAHCC)546099787AQ27R
02UniProtVAR_024771L116PMMAC_HUMANDisease (MMAHCC)121918240AL116P
03UniProtVAR_024772H122RMMAC_HUMANDisease (MMAHCC)  ---AH122R
04UniProtVAR_024773Y130HMMAC_HUMANDisease (MMAHCC)372670428AY130H
05UniProtVAR_024774G147AMMAC_HUMANDisease (MMAHCC)140522266AG147A
06UniProtVAR_024775G147DMMAC_HUMANDisease (MMAHCC)140522266AG147D
07UniProtVAR_024776G156DMMAC_HUMANDisease (MMAHCC)  ---AG156D
08UniProtVAR_024777W157CMMAC_HUMANDisease (MMAHCC)  ---AW157C
09UniProtVAR_024778R161GMMAC_HUMANDisease (MMAHCC)  ---AR161G
10UniProtVAR_024779R161QMMAC_HUMANDisease (MMAHCC)121918243AR161Q
11UniProtVAR_024780R189SMMAC_HUMANDisease (MMAHCC)200895671AR189S
12UniProtVAR_024781L193PMMAC_HUMANDisease (MMAHCC)  ---AL193P
13UniProtVAR_024782R206PMMAC_HUMANDisease (MMAHCC)  ---AR206P
14UniProtVAR_024783R206WMMAC_HUMANDisease (MMAHCC)  ---AR206W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (14, 28)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_024770Q27RMMAC_HUMANDisease (MMAHCC)546099787AQ27R
02UniProtVAR_024771L116PMMAC_HUMANDisease (MMAHCC)121918240AL116P
03UniProtVAR_024772H122RMMAC_HUMANDisease (MMAHCC)  ---AH122R
04UniProtVAR_024773Y130HMMAC_HUMANDisease (MMAHCC)372670428AY130H
05UniProtVAR_024774G147AMMAC_HUMANDisease (MMAHCC)140522266AG147A
06UniProtVAR_024775G147DMMAC_HUMANDisease (MMAHCC)140522266AG147D
07UniProtVAR_024776G156DMMAC_HUMANDisease (MMAHCC)  ---AG156D
08UniProtVAR_024777W157CMMAC_HUMANDisease (MMAHCC)  ---AW157C
09UniProtVAR_024778R161GMMAC_HUMANDisease (MMAHCC)  ---AR161G
10UniProtVAR_024779R161QMMAC_HUMANDisease (MMAHCC)121918243AR161Q
11UniProtVAR_024780R189SMMAC_HUMANDisease (MMAHCC)200895671AR189S
12UniProtVAR_024781L193PMMAC_HUMANDisease (MMAHCC)  ---AL193P
13UniProtVAR_024782R206PMMAC_HUMANDisease (MMAHCC)  ---AR206P
14UniProtVAR_024783R206WMMAC_HUMANDisease (MMAHCC)  ---AR206W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3SC0)

(-) Exons   (0, 0)

(no "Exon" information available for 3SC0)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:237
 aligned with MMAC_HUMAN | Q9Y4U1 from UniProtKB/Swiss-Prot  Length:282

    Alignment length:237
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       
           MMAC_HUMAN     2 EPKVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPLPGPTLAFLVLSTPAMFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQ 238
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhh......eeeeeeee..hhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.....eeee............hhhhhhhhh...eeehhhhh............eee........eeeeeeeeeeee..............hhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhh........ Sec.struct. author
             SAPs(SNPs) (1) -------------------------R----------------------------------------------------------------------------------------P-----R-------H----------------A--------DC---G---------------------------S---P------------P-------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -------------------------------------------------------------------------------------------------------------------------------------------------D-------------Q--------------------------------------------W-------------------------------- SAPs(SNPs) (2)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3sc0 A   2 EPKVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPLPGPTLAFLVLSTPAMFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQ 238
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3SC0)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3SC0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3SC0)

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)
Chain A   (MMAC_HUMAN | Q9Y4U1)
molecular function
    GO:0031419    cobalamin binding    Interacting selectively and non-covalently with cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
    GO:0033787    cyanocobalamin reductase (cyanide-eliminating) activity    Catalysis of the reaction: cob(I)alamin + hydrogen cyanide + NADP(+) = cyanocob(III)alamin + H(+) + NADPH.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0009236    cobalamin biosynthetic process    The chemical reactions and pathways resulting in the formation of cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
    GO:0009235    cobalamin metabolic process    The chemical reactions and pathways involving cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    COB  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3sc0)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3sc0
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MMAC_HUMAN | Q9Y4U1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  277400
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MMAC_HUMAN | Q9Y4U1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MMAC_HUMAN | Q9Y4U1: 3sby 3sbz 3som 5uos

(-) Related Entries Specified in the PDB File

3sby 3sbz