Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF SPERMIDINE N-ACETYLTRANSFERASE SPEG FROM VIBRIO CHOLERAE
 
Authors :  E. V. Filippova, G. Minasov, L. Shuvalova, O. Kiryukhina, W. F. Anderso For Structural Genomics Of Infectious Diseases (Csgid)
Date :  06 Jan 17  (Deposition) - 25 Jan 17  (Release) - 25 Jan 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.15
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,B,C  (4x)
Keywords :  Speg, Spermidine, Spermine, Structural Genomics, Center For Structural Genomics Of Infectious Diseases, Csgid, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. V. Filippova, G. Minasov, L. Shuvalova, O. Kiryukhina, W. F. Anderson, Center For Structural Genomics Of Infectious Diseases (Csgid)
Structure Of Spermidine N-Acetyltransferase Speg From Vibri Cholerae
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - SPERMIDINE N(1)-ACETYLTRANSFERASE
    ChainsA, B, C
    EC Number2.3.1.57
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidMCSG7
    Expression System StrainBL21(DE3) MAGIC
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneSPEG, VC_A0947
    Organism ScientificVIBRIO CHOLERAE O1
    Organism Taxid127906
    SynonymSAT, SPERMIDINE/SPERMINE N(1)-ACETYLTRANSFERASE, SSAT

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (4x)ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 15)

Asymmetric Unit (5, 15)
No.NameCountTypeFull Name
1ACT3Ligand/IonACETATE ION
2CA9Ligand/IonCALCIUM ION
3EOH1Ligand/IonETHANOL
4MOH1Ligand/IonMETHANOL
5MRD1Ligand/Ion(4R)-2-METHYLPENTANE-2,4-DIOL
Biological Unit 1 (4, 24)
No.NameCountTypeFull Name
1ACT12Ligand/IonACETATE ION
2CA-1Ligand/IonCALCIUM ION
3EOH4Ligand/IonETHANOL
4MOH4Ligand/IonMETHANOL
5MRD4Ligand/Ion(4R)-2-METHYLPENTANE-2,4-DIOL

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLU A:33 , GLU A:75 , HOH A:362 , GLU C:75 , CA C:201binding site for residue CA A 201
02AC2SOFTWAREGLU A:34 , PRO A:35 , GLU A:41 , ASN B:53 , HOH B:329 , HOH B:361binding site for residue CA A 202
03AC3SOFTWAREASN A:22 , HOH A:306binding site for residue ACT A 203
04AC4SOFTWAREHIS A:122 , VAL A:123 , ALA A:124 , HOH A:376binding site for residue MRD A 204
05AC5SOFTWAREGLU B:33 , GLU B:75 , HOH B:302binding site for residue CA B 201
06AC6SOFTWAREGLU B:33 , GLU B:75 , CA B:203 , HOH B:364binding site for residue CA B 202
07AC7SOFTWAREGLU B:33 , GLU B:75 , CA B:202binding site for residue CA B 203
08AC8SOFTWAREGLU B:34 , PRO B:35 , GLU B:41 , ASN C:53 , HOH C:304 , HOH C:328binding site for residue CA B 204
09AC9SOFTWAREILE B:151binding site for residue ACT B 205
10AD1SOFTWAREASN B:53binding site for residue EOH B 206
11AD2SOFTWAREGLU A:33 , GLU A:75 , CA A:201 , HOH A:344 , GLU C:33 , GLU C:75 , CA C:202 , HOH C:306binding site for residue CA C 201
12AD3SOFTWAREGLU A:75 , HOH A:316 , GLU C:33 , GLU C:75 , CA C:201 , HOH C:346binding site for residue CA C 202
13AD4SOFTWAREASN A:53 , HOH A:317 , HOH A:364 , GLU C:34 , PRO C:35 , GLU C:41binding site for residue CA C 203
14AD5SOFTWAREILE C:151 , HOH C:353binding site for residue ACT C 204

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5UG4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5UG4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5UG4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5UG4)

(-) Exons   (0, 0)

(no "Exon" information available for 5UG4)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:170
                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.hhhhhhhhhhhhhhhh..eee..eee.hhhhhhhhhhhh......eeeeee.....eeeeeeeeeee....eeeeeeee.hhhh...hhhhhhhhhhhhhhhh....eeeeeee..hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeeehhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ug4 A   2 NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR 171
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171

Chain B from PDB  Type:PROTEIN  Length:169
                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.hhhhhhhhhhhhhhhh..eee..eee.hhhhhhhhhhhh......eeeeee.....eeeeeeeeeee....eeeeeeee.hhhh...hhhhhhhhhhhhhhhh....eeeeeee..hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeeehhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ug4 B   2 NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLN 170
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161         

Chain C from PDB  Type:PROTEIN  Length:171
                                                                                                                                                                                                           
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.hhhhhhhhhhhhhhhh..eee..eee.hhhhhhhhhhhh......eeeeee.....eeeeeeeeeee....eeeeeeee.hhhh...hhhhhhhhhhhhhhhh....eeeeeee..hhhhhhhhhhh..eeeeeeeeeeee..eeeeeeeeeeehhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ug4 C   3 SQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNRSE 173
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5UG4)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5UG4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5UG4)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EOH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MOH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MRD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ug4)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ug4
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ATDA_VIBCH | Q9KL03
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.57
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ATDA_VIBCH | Q9KL03
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ATDA_VIBCH | Q9KL034jjx 4jly 4mhd 4mi4 4mj8 4ncz 4r57 4r87 4ygo 5cnp

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5UG4)