Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE HUMAN HEMOGLOBIN MUTANT HB PROVIDENCE (A-GLY-C:V1M; B,D:V1M,K82D; FERROUS, CARBONMONOXY BOUND)
 
Authors :  J. Soman, J. S. Olson
Date :  08 Aug 16  (Deposition) - 31 Aug 16  (Release) - 31 Aug 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Heme, Oxygen Transport, Distal Histidine, Oxidative Stability (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Soman, J. S. Olson
Structure Of The Human Hemoglobin Mutant Hb Providence (A-Gly-C:V1M; B, D:V1M, K82D; Ferrous, Carbonmonoxy Bound)
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HEMOGLOBIN SUBUNIT ALPHA
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneHBA1, HBA2
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymALPHA-GLOBIN,HEMOGLOBIN ALPHA CHAIN
 
Molecule 2 - HEMOGLOBIN SUBUNIT BETA
    ChainsB
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneHBB
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymBETA-GLOBIN,HEMOGLOBIN BETA CHAIN

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric Unit (3, 5)
No.NameCountTypeFull Name
1CMO2Ligand/IonCARBON MONOXIDE
2HEM2Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
3PO41Ligand/IonPHOSPHATE ION
Biological Unit 1 (3, 10)
No.NameCountTypeFull Name
1CMO4Ligand/IonCARBON MONOXIDE
2HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE
3PO42Ligand/IonPHOSPHATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:42 , PHE A:43 , HIS A:45 , PHE A:46 , HIS A:58 , LYS A:61 , LEU A:83 , HIS A:87 , LEU A:91 , VAL A:93 , ASN A:97 , PHE A:98 , LEU A:101 , LEU A:136 , CMO A:202 , HOH A:368binding site for residue HEM A 201
2AC2SOFTWARELEU A:29 , HIS A:58 , VAL A:62 , HEM A:201binding site for residue CMO A 202
3AC3SOFTWARESER A:49 , HIS A:50 , GLY A:51 , SER A:52 , LYS A:56 , HOH A:301 , HOH A:302 , HOH A:304binding site for residue PO4 A 203
4AC4SOFTWAREPRO A:4 , THR B:38 , PHE B:41 , PHE B:42 , HIS B:63 , LYS B:66 , PHE B:71 , HIS B:92 , LEU B:96 , ASN B:102 , LEU B:141 , CMO B:202 , HOH B:313binding site for residue HEM B 201
5AC5SOFTWAREHIS B:63 , VAL B:67 , HEM B:201binding site for residue CMO B 202

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5SW7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5SW7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5SW7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5SW7)

(-) Exons   (0, 0)

(no "Exon" information available for 5SW7)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:142
                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5sw7 A   1 MLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYRG 142
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140  

Chain B from PDB  Type:PROTEIN  Length:146
                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5sw7 B   1 MHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLDGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 146
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5SW7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5SW7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5SW7)

(-) Gene Ontology  (34, 58)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CMO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5sw7)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5sw7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HBA_HUMAN | P69905
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  HBB_HUMAN | P68871
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HBA_HUMAN | P69905
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  HBB_HUMAN | P68871
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HBA_HUMAN | P699051a00 1a01 1a0u 1a0z 1a3n 1a3o 1a9w 1abw 1aby 1aj9 1b86 1bab 1bbb 1bij 1buw 1bz0 1bz1 1bzz 1c7b 1c7c 1c7d 1cls 1cmy 1coh 1dke 1dxt 1dxu 1dxv 1fdh 1fn3 1g9v 1gbu 1gbv 1gli 1gzx 1hab 1hac 1hba 1hbb 1hbs 1hco 1hdb 1hga 1hgb 1hgc 1hho 1ird 1j3y 1j3z 1j40 1j41 1j7s 1j7w 1j7y 1jy7 1k0y 1k1k 1kd2 1lfl 1lfq 1lft 1lfv 1lfy 1lfz 1ljw 1m9p 1mko 1nej 1nih 1nqp 1o1i 1o1j 1o1k 1o1l 1o1m 1o1n 1o1o 1o1p 1qi8 1qsh 1qsi 1qxd 1qxe 1r1x 1r1y 1rps 1rq3 1rq4 1rqa 1rvw 1sdk 1sdl 1shr 1si4 1thb 1uiw 1vwt 1xxt 1xy0 1xye 1xz2 1xz4 1xz5 1xz7 1xzu 1xzv 1y01 1y09 1y0a 1y0c 1y0d 1y0t 1y0w 1y22 1y2z 1y31 1y35 1y45 1y46 1y4b 1y4f 1y4g 1y4p 1y4q 1y4r 1y4v 1y5f 1y5j 1y5k 1y7c 1y7d 1y7g 1y7z 1y83 1y85 1y8w 1ydz 1ye0 1ye1 1ye2 1yen 1yeo 1yeq 1yeu 1yev 1yff 1yg5 1ygd 1ygf 1yh9 1yhe 1yhr 1yie 1yih 1yvq 1yvt 1yzi 1z8u 2d5z 2d60 2dn1 2dn2 2dn3 2dxm 2h35 2hbc 2hbd 2hbe 2hbf 2hbs 2hco 2hhb 2hhd 2hhe 2m6z 2w6v 2w72 2yrs 3b75 3d17 3d7o 3dut 3hhb 3hxn 3ia3 3ic0 3ic2 3kmf 3nl7 3nmm 3odq 3onz 3oo4 3oo5 3ovu 3p5q 3qjb 3qjc 3qjd 3qje 3r5i 3s48 3s65 3s66 3szk 3wcp 3whm 4fc3 4hhb 4ij2 4l7y 4m4a 4m4b 4mqc 4mqg 4mqh 4mqi 4mqj 4mqk 4n7n 4n7o 4n7p 4n8t 4ni0 4ni1 4rol 4rom 4wjg 4x0l 4xs0 5e29 5e6e 5e83 5ee4 5hu6 5hy8 5jdo 5kdq 5me2 5ni1 5u3i 5ucu 5ufj 5urc 6hbw
        HBB_HUMAN | P688711a00 1a01 1a0u 1a0z 1a3n 1a3o 1abw 1aby 1aj9 1b86 1bab 1bbb 1bij 1buw 1bz0 1bz1 1bzz 1c7b 1c7c 1c7d 1cbl 1cbm 1ch4 1cls 1cmy 1coh 1dke 1dxt 1dxu 1dxv 1fn3 1g9v 1gbu 1gbv 1gli 1gzx 1hab 1hac 1hba 1hbb 1hbs 1hco 1hdb 1hga 1hgb 1hgc 1hho 1ird 1j3y 1j3z 1j40 1j41 1j7s 1j7w 1j7y 1jy7 1k0y 1k1k 1kd2 1lfl 1lfq 1lft 1lfv 1lfy 1lfz 1ljw 1m9p 1mko 1nej 1nih 1nqp 1o1i 1o1j 1o1k 1o1l 1o1m 1o1n 1o1o 1o1p 1qi8 1qsh 1qsi 1qxd 1qxe 1r1x 1r1y 1rps 1rq3 1rq4 1rqa 1rvw 1sdk 1sdl 1thb 1uiw 1vwt 1xxt 1xy0 1xye 1xz2 1xz4 1xz5 1xz7 1xzu 1xzv 1y09 1y0a 1y0c 1y0d 1y0t 1y0w 1y22 1y2z 1y31 1y35 1y45 1y46 1y4b 1y4f 1y4g 1y4p 1y4q 1y4r 1y4v 1y5f 1y5j 1y5k 1y7c 1y7d 1y7g 1y7z 1y83 1y85 1y8w 1ydz 1ye0 1ye1 1ye2 1yen 1yeo 1yeq 1yeu 1yev 1yff 1yg5 1ygd 1ygf 1yh9 1yhe 1yhr 1yie 1yih 1yvq 1yvt 1yzi 2d5z 2d60 2dn1 2dn2 2dn3 2dxm 2h35 2hbc 2hbd 2hbe 2hbf 2hbs 2hco 2hhb 2hhd 2hhe 2m6z 2w6v 2w72 2yrs 3b75 3d17 3d7o 3dut 3hhb 3hxn 3ic0 3ic2 3kmf 3nl7 3nmm 3odq 3onz 3oo4 3oo5 3p5q 3qjb 3qjc 3qjd 3qje 3r5i 3s65 3s66 3szk 3w4u 3wcp 3whm 4fc3 4hhb 4ij2 4l7y 4m4a 4m4b 4mqc 4mqg 4mqh 4mqi 4n7n 4n7o 4n7p 4n8t 4ni0 4ni1 4rol 4rom 4wjg 4x0l 4xs0 5e29 5e6e 5e83 5ee4 5hu6 5hy8 5jdo 5kdq 5me2 5ni1 5u3i 5ucu 5ufj 5urc 6hbw

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5SW7)