Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF FACTOR VIIA IN COMPLEX WITH N-(6-AMINOPYRIDIN-3-YL)-5-HYDROXY-1-PHENYLPYRAZOLE-4-CARBOXAMIDE
 
Authors :  M. Stihle, A. Mayweg, S. Roever, M. G. Rudolph
Date :  10 Nov 16  (Deposition) - 21 Jun 17  (Release) - 21 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.40
Chains :  Asym./Biol. Unit :  A,C
Keywords :  Glycoprotein, Hydrolase, Serine Protease, Plasma, Blood Coagulation Factor, Protein Inhibitor Complex, Calcium-Binding, Hydrolase- Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Mayweg, S. Roever, M. G. Rudolph
Crystal Structure Of A Factor Viia Complex
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - COAGULATION FACTOR VII LIGHT CHAIN
    ChainsA
    EC Number3.4.21.21
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneF7
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPROCONVERTIN,SERUM PROTHROMBIN CONVERSION ACCELERATOR,SPCA
 
Molecule 2 - COAGULATION FACTOR VII HEAVY CHAIN
    ChainsC
    EC Number3.4.21.21
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneF7
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPROCONVERTIN,SERUM PROTHROMBIN CONVERSION ACCELERATOR,SPCA

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 12)

Asymmetric/Biological Unit (5, 12)
No.NameCountTypeFull Name
17ZM1Ligand/IonN-(6-AMINOPYRIDIN-3-YL)-5-HYDROXY-1-PHENYLPYRAZOLE-4-CARBOXAMIDE
2CA1Ligand/IonCALCIUM ION
3CL3Ligand/IonCHLORIDE ION
4GOL5Ligand/IonGLYCEROL
5SO42Ligand/IonSULFATE ION

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:163 , ASP A:164 , HOH A:405 , ARG C:331binding site for residue SO4 A 301
02AC2SOFTWAREGLY A:196 , LYS A:197 , ILE A:198 , LEU A:201 , GLU A:202 , HIS C:411 , GLY C:414 , THR C:415 , TRP C:416binding site for residue GOL A 302
03AC3SOFTWAREARG A:173 , CYS A:174 , SER A:179 , LEU A:180 , HOH A:401 , HOH A:403 , HOH A:406 , HOH A:407 , HOH A:433 , HOH A:449binding site for residue GOL A 303
04AC4SOFTWAREGLU C:270 , ASP C:272 , GLU C:275 , GLU C:280 , HOH C:648 , HOH C:791binding site for residue CA C 501
05AC5SOFTWAREARG C:262 , GLY C:458 , VAL C:459binding site for residue CL C 503
06AC6SOFTWAREARG C:284 , GLN C:310binding site for residue CL C 504
07AC7SOFTWAREMET C:366 , THR C:367 , ARG C:439 , HOH C:634 , HOH C:694 , HOH C:786binding site for residue SO4 C 505
08AC8SOFTWAREPHE C:255 , TRP C:261 , ILE C:290 , PRO C:296 , HOH C:620 , HOH C:651 , HOH C:654 , HOH C:737binding site for residue GOL C 506
09AC9SOFTWARETYR A:193 , ASP C:279 , THR C:315 , ASP C:316 , HIS C:317 , HOH C:655 , HOH C:751binding site for residue GOL C 507
10AD1SOFTWARELEU A:180 , ALA A:182 , GLN C:236 , THR C:353 , LEU C:355 , HOH C:615 , HOH C:696 , HOH C:705 , HOH C:754binding site for residue GOL C 508
11AD2SOFTWAREHIS C:253 , CYS C:254 , ASP C:398 , SER C:399 , CYS C:400 , LYS C:401 , SER C:404 , VAL C:422 , SER C:423 , TRP C:424 , GLY C:425 , GLY C:427 , HOH C:617 , HOH C:672binding site for residue 7ZM C 509

(-) SS Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1A:151 -A:162
2A:158 -A:172
3A:174 -A:187
4A:195 -C:322
5C:219 -C:224
6C:238 -C:254
7C:370 -C:389
8C:400 -C:428

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Phe C:465 -Pro C:466

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5PAV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5PAV)

(-) Exons   (0, 0)

(no "Exon" information available for 5PAV)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:58
                                                                                          
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhh..eeeee...eeeee....eee......eee........hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                 5pav A 149 LICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNA 206
                                   158       168       178       188       198        

Chain C from PDB  Type:PROTEIN  Length:249
                                                                                                                                                                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeee..eeeeeeee....eeeehhhhhh...hhh.eeeee............eeeeeeeeeee............eeeee................hhhhhhhhhhhh.eeeeee..............eeeeeeeehhhhhhhhh.......eeee................eeeeee..eeeeeeeeee..........eeeee...hhhhhhhhhh.......eeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5pav C 213 IVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDRGATALELMVLNVPRLMTQDCLQQSRPNITEYMFCAGYSDGSKDSCKGDSGGPHATHYRGTWYLTGIVSWGQGCATVGHFGVYTRVSQYIEWLQKLMRSEPRPGVLLRAPFP 466
                                   222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372  ||   387       397       407       417       427       437       447       457         
                                                                                                                                                                                            375|                                                                                     
                                                                                                                                                                                             381                                                                                     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5PAV)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5PAV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5PAV)

(-) Gene Ontology  (35, 35)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    7ZM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Phe C:465 - Pro C:466   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5pav
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FA7_HUMAN | P08709
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.21
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FA7_HUMAN | P08709
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FA7_HUMAN | P087091bf9 1cvw 1dan 1dva 1f7e 1f7m 1fak 1ff7 1ffm 1j9c 1jbu 1kli 1klj 1nl8 1o5d 1qfk 1w0y 1w2k 1w7x 1w8b 1wqv 1wss 1wtg 1wun 1wv7 1ygc 1z6j 2a2q 2aei 2aer 2b7d 2b8o 2bz6 2c4f 2ec9 2f9b 2fir 2flb 2flr 2puq 2zp0 2zwl 2zzu 3ela 3th2 3th3 3th4 4ibl 4ish 4isi 4jyu 4jyv 4jzd 4jze 4jzf 4na9 4ng9 4nga 4x8s 4x8t 4x8u 4x8v 4ylq 4yt6 4yt7 4z6a 4zma 4zxx 4zxy 5i46 5l2y 5l2z 5l30 5pa8 5pa9 5paa 5pab 5pac 5pae 5paf 5pag 5pai 5paj 5pak 5pam 5pan 5pao 5paq 5par 5pas 5pat 5pau 5paw 5pax 5pay 5pb0 5pb1 5pb2 5pb3 5pb4 5pb5 5pb6 5tqe 5tqf 5tqg 5u6j

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5PAV)