Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  SYNTHESIS AND BIOLOGICAL EVALUATION OF NEW TRIAZOLO AND IMIDAZOLOPYRIDINE RORGT INVERSE AGONISTS
 
Authors :  J. Kallen
Date :  31 Oct 16  (Deposition) - 14 Dec 16  (Release) - 28 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.77
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Nuclear Hormone Receptor, Ligand-Binding Domain, Inverse Agonist, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Hintermann, C. Guntermann, H. Mattes, D. A. Carcache, J. Wagner, A. Vulpetti, A. Billich, J. Dawson, K. Kaupmann, J. Kallen, R. Stringer, D. Orain
Synthesis And Biological Evaluation Of New Triazolo- And Imidazolopyridine Ror Gamma T Inverse Agonists.
Chemmedchem V. 11 2640 2016
PubMed-ID: 27902884  |  Reference-DOI: 10.1002/CMDC.201600500

(-) Compounds

Molecule 1 - NUCLEAR RECEPTOR ROR-GAMMA
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Fragment: C-TERMINAL DOMAIN, LIGAND BINDING DOMAIN, UNP RESIDUES 263- 491
    Gene: RORC, NR1F3, RORG, RZRG
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: NUCLEAR RECEPTOR RZR-GAMMA,NUCLEAR RECEPTOR SUBFAMILY 1 GROUP F MEMBER 3,RAR-RELATED ORPHAN RECEPTOR C,RETINOID-RELATED ORPHAN RECEPTOR-GAMMA

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1Q6Y4Ligand/Ion~{N}-[8-[[(3~{S})-4-CYCLOPENTYLCARBONYL-3-METHYL-PIPERAZIN-1-YL]METHYL]-7-METHYL-IMIDAZO[1,2-A]PYRIDIN-6-YL]-2-METHYL-PYRIMIDINE-5-CARBOXAMIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1Q6Y2Ligand/Ion~{N}-[8-[[(3~{S})-4-CYCLOPENTYLCARBONYL-3-METHYL-PIPERAZIN-1-YL]METHYL]-7-METHYL-IMIDAZO[1,2-A]PYRIDIN-6-YL]-2-METHYL-PYRIMIDINE-5-CARBOXAMIDE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1Q6Y2Ligand/Ion~{N}-[8-[[(3~{S})-4-CYCLOPENTYLCARBONYL-3-METHYL-PIPERAZIN-1-YL]METHYL]-7-METHYL-IMIDAZO[1,2-A]PYRIDIN-6-YL]-2-METHYL-PYRIMIDINE-5-CARBOXAMIDE

(-) Sites  (26, 26)

Asymmetric Unit (26, 26)
No.NameEvidenceResiduesDescription
01AC1SOFTWARECYS A:320 , HIS A:323 , LEU A:324 , MET A:365 , ALA A:368 , VAL A:376 , PHE A:377 , PHE A:378 , ILE A:400 , PHE A:401 , SER A:404 , HIS A:479 , PHE A:486 , HOH A:653 , HOH A:708 , HOH A:711binding site for residue Q6Y A 501
02AC2SOFTWARECYS B:320 , HIS B:323 , LEU B:324 , MET B:365 , ALA B:368 , VAL B:376 , PHE B:377 , LEU B:396 , ILE B:397 , ILE B:400 , PHE B:401 , SER B:404 , HIS B:479 , HOH B:629 , HOH B:686 , HOH B:689binding site for residue Q6Y B 501
03AC3SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
04AC4SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
05AC5SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
06AC6SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
07AC7SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
08AC8SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
09AC9SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
10AD1SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
11AD2SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
12AD3SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
13AD4SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
14AD5SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
15AD6SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
16AD7SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
17AD8SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
18AD9SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
19AE1SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
20AE2SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
21AE3SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
22AE4SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
23AE5SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
24AE6SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
25AE7SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502
26AE8SOFTWARETHR A:325 , ILE A:328 , GLN A:329 , VAL A:332 , GLU A:333 , LEU A:353 , LYS A:354 , MET A:358 , HOH A:657 , VAL B:332 , GLN B:346 , ILE B:350 , LEU B:353 , LYS B:354 , HOH B:663binding site for residues Q6Y A 502 and Q6Y B 502

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5M96)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5M96)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5M96)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5M96)

(-) Exons   (0, 0)

(no "Exon" information available for 5M96)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:225
                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhh....hhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh...ee....eeee..eeehhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5m96 A 265 ASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLSKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHL 489
                                   274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484     


Chain B from PDB  Type:PROTEIN  Length:223
                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh...ee....eeee..eeehhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh...hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5m96 B 265 ASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLSKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQ 487
                                   274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5M96)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5M96)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5M96)

(-) Gene Ontology  (37, 37)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    Q6Y  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5m96)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5m96
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RORG_HUMAN | P51449
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RORG_HUMAN | P51449
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RORG_HUMAN | P51449: 3b0w 3kyt 3l0j 3l0l 4nb6 4nie 4qm0 4s14 4wlb 4wpf 4wqp 4xt9 4ymq 4ypq 4zjr 4zjw 4zom 5aph 5apj 5apk 5ayg 5c4o 5c4s 5c4t 5c4u 5ejv 5eth 5g42 5g43 5g44 5g45 5g46 5ixk 5iz0 5k38 5k3l 5k3m 5k3n 5k6e 5k74 5lwp 5nti 5ntk 5ntn 5ntp 5ntq 5ntw 5nu1 5ufo 5ufr 5uhi 5vb3 5vb5 5vb6 5vb7 5x8q

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5M96)