Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  RORGAMMA (263-509) COMPLEXED WITH GSK2435341A AND SRC2
 
Authors :  Y. Wang, Y. Ma
Date :  23 Jan 15  (Deposition) - 12 Aug 15  (Release) - 16 Sep 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.25
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Unknown Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Wang, T. Yang, Q. Liu, Y. Ma, L. Yang, L. Zhou, Z. Xiang, Z. Cheng, S. Lu L. A. Orband-Miller, W. Zhang, Q. Wu, K. Zhang, Y. Li, J. N. Xiang, J. D. Elliott, S. Leung, F. Ren, X. Lin
Discovery Of N-(4-Aryl-5-Aryloxy-Thiazol-2-Yl)-Amides As Potent Ror Gamma T Inverse Agonists
Bioorg. Med. Chem. V. 23 5293 2015
PubMed-ID: 26277758  |  Reference-DOI: 10.1016/J.BMC.2015.07.068

(-) Compounds

Molecule 1 - NUCLEAR RECEPTOR ROR-GAMMA
    ChainsA
    FragmentUNP RESIDUES 265-507
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymNUCLEAR RECEPTOR RZR-GAMMA,NUCLEAR RECEPTOR SUBFAMILY 1 GROUP F MEMBER 3,RAR-RELATED ORPHAN RECEPTOR C,RETINOID-RELATED ORPHAN RECEPTOR-GAMMA
 
Molecule 2 - LYS-ILE-LEU-HIS-ARG-LEU-LEU-GLN
    ChainsB
    EngineeredYES
    Organism ScientificSYNTHETIC CONSTRUCT
    Organism Taxid32630
    SyntheticYES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric/Biological Unit (2, 3)
No.NameCountTypeFull Name
143V1Ligand/IonN-[4-(2,5-DICHLOROPHENYL)-5-PHENYL-1,3-THIAZOL-2-YL]-2-[4-(ETHYLSULFONYL)PHENYL]ACETAMIDE
2SO42Ligand/IonSULFATE ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1PSILOCYS A:285 , GLN A:286 , LEU A:287 , LEU A:292 , TRP A:317 , CYS A:320 , ALA A:321 , HIS A:323 , LEU A:324 , ALA A:327 , MET A:358 , VAL A:361 , ARG A:364 , MET A:365 , ARG A:367 , ALA A:368 , TYR A:369 , VAL A:376 , PHE A:377 , PHE A:378 , GLU A:379 , PHE A:388 , LEU A:391 , CYS A:393 , LEU A:396 , ILE A:397 , ILE A:400 , PHE A:401 , SER A:404 , HIS A:479 , TYR A:502Pocket 1 in Model 1 Assembly 1 (Ligand L_LIG_1 ) (Entity 3)
2AC2PSILOGLU A:359 , TYR A:420 , LEU A:423 , VAL A:424 , ILE A:426 , ASN A:427 , HIS A:429 , ARG A:430 , PRO A:431 , GLN A:443 , GLU A:447 , PHE A:450 , HIS A:451 , LEU A:463 , LEU A:466 , PRO A:467 , PRO A:468 , LYS A:469 , LEU A:472 , ARG A:473Pocket 2 in Model 1 Assembly 1 (Ligand M_SO4_2 ) (Entity 4)
3AC3PSILOLEU A:289 , LEU A:293 , ARG A:296 , CYS A:366 , ARG A:367 , ALA A:368 , TYR A:369 , ASN A:370 , ALA A:371 , ASP A:372 , LEU A:407 , SER A:408 , LEU A:410 , HIS A:411 , PHE A:412 , GLU A:414 , ILE A:417Pocket 3 in Model 1 Assembly 1
4AC4PSILOGLU A:504 , LEU A:501 , PRO A:500 , HOH A:716 , LEU A:353 , ILE A:350 , LEU A:505 , LYS A:354 , VAL A:332 , GLN A:346 , LYS A:336 , HOH A:735 , GLN A:349 , MET A:342 , PHE A:341Neighbourhood of 1:B_LYS_688 _B_ILE_689 _B_LEU_690 _B_HIS_691 _B_ARG_692 _B_LEU_693 _B_LEU_694 _B_GLN_ 695 (Entity 2)
5AC5PSILOGLN A:286 , HOH A:727 , MET A:365 , VAL A:361 , ARG A:364 , CYS A:285 , HOH A:725 , ARG A:367 , LEU A:292 , LEU A:287 , ALA A:368 , HOH A:724 , PHE A:377 , HOH A:733 , PHE A:378 , HIS A:323 , VAL A:376 , LEU A:324 , CYS A:320 , HIS A:479 , MET A:358 , ILE A:400 , PHE A:388 , PHE A:401 , SER A:404 , ILE A:397Neighbourhood of 1:L_LIG_1 (Entity 3)
6AC6SOFTWARECYS A:285 , GLN A:286 , LEU A:287 , LEU A:292 , CYS A:320 , HIS A:323 , ARG A:364 , ARG A:367 , ALA A:368 , PHE A:377 , PHE A:378 , PHE A:388 , ILE A:400 , PHE A:401 , HOH A:724binding site for residue 43V A 601
7AC7SOFTWAREARG A:310 , LYS A:469 , GLY A:470 , SO4 A:603binding site for residue SO4 A 602
8AC8SOFTWARELYS A:311 , PRO A:468 , LYS A:469 , SO4 A:602binding site for residue SO4 A 603

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4XT9)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4XT9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4XT9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4XT9)

(-) Exons   (0, 0)

(no "Exon" information available for 4XT9)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:243
                                                                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhh....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh...ee....eeee..eeehhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xt9 A 265 ASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFS 507
                                   274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504   

Chain B from PDB  Type:PROTEIN  Length:8
                                        
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author .hhhhhhh Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE -------- PROSITE
                 Transcript -------- Transcript
                 4xt9 B 688 KILHRLLQ 695

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4XT9)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4XT9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4XT9)

(-) Gene Ontology  (37, 37)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    43V  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4xt9)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4xt9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RORG_HUMAN | P51449
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RORG_HUMAN | P51449
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RORG_HUMAN | P514493b0w 3kyt 3l0j 3l0l 4nb6 4nie 4qm0 4s14 4wlb 4wpf 4wqp 4ymq 4ypq 4zjr 4zjw 4zom 5aph 5apj 5apk 5ayg 5c4o 5c4s 5c4t 5c4u 5ejv 5eth 5g42 5g43 5g44 5g45 5g46 5ixk 5iz0 5k38 5k3l 5k3m 5k3n 5k6e 5k74 5lwp 5m96 5nti 5ntk 5ntn 5ntp 5ntq 5ntw 5nu1 5ufo 5ufr 5uhi 5vb3 5vb5 5vb6 5vb7 5x8q

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4XT9)