4XT9 - JenaLib

Title :   RORGAMMA (263-509) COMPLEXED WITH GSK2435341A AND SRC2

Authors :   Y. Wang, Y. Ma

Date :   23 Jan 15 (Deposition) - 12 Aug 15 (Release) - 16 Sep 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.25

Chains :   Asym./Biol. Unit : A,B

Keywords :   Unknown Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Wang, T. Yang, Q. Liu, Y. Ma, L. Yang, L. Zhou, Z. Xiang, Z. Cheng, S. Lu L. A. Orband-Miller, W. Zhang, Q. Wu, K. Zhang, Y. Li, J. N. Xiang, J. D. Elliott, S. Leung, F. Ren, X. Lin
Discovery Of N-(4-Aryl-5-Aryloxy-Thiazol-2-Yl)-Amides As Potent Ror Gamma T Inverse Agonists
Bioorg. Med. Chem. V. 23 5293 2015
PubMed-ID: 26277758 | Reference-DOI: 10.1016/J.BMC.2015.07.068

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 3)

Sites (8, 8)

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	PSILO	CYS A:285 , GLN A:286 , LEU A:287 , LEU A:292 , TRP A:317 , CYS A:320 , ALA A:321 , HIS A:323 , LEU A:324 , ALA A:327 , MET A:358 , VAL A:361 , ARG A:364 , MET A:365 , ARG A:367 , ALA A:368 , TYR A:369 , VAL A:376 , PHE A:377 , PHE A:378 , GLU A:379 , PHE A:388 , LEU A:391 , CYS A:393 , LEU A:396 , ILE A:397 , ILE A:400 , PHE A:401 , SER A:404 , HIS A:479 , TYR A:502	Pocket 1 in Model 1 Assembly 1 (Ligand L_LIG_1 ) (Entity 3)
2	AC2	PSILO	GLU A:359 , TYR A:420 , LEU A:423 , VAL A:424 , ILE A:426 , ASN A:427 , HIS A:429 , ARG A:430 , PRO A:431 , GLN A:443 , GLU A:447 , PHE A:450 , HIS A:451 , LEU A:463 , LEU A:466 , PRO A:467 , PRO A:468 , LYS A:469 , LEU A:472 , ARG A:473	Pocket 2 in Model 1 Assembly 1 (Ligand M_SO4_2 ) (Entity 4)
3	AC3	PSILO	LEU A:289 , LEU A:293 , ARG A:296 , CYS A:366 , ARG A:367 , ALA A:368 , TYR A:369 , ASN A:370 , ALA A:371 , ASP A:372 , LEU A:407 , SER A:408 , LEU A:410 , HIS A:411 , PHE A:412 , GLU A:414 , ILE A:417	Pocket 3 in Model 1 Assembly 1
4	AC4	PSILO	GLU A:504 , LEU A:501 , PRO A:500 , HOH A:716 , LEU A:353 , ILE A:350 , LEU A:505 , LYS A:354 , VAL A:332 , GLN A:346 , LYS A:336 , HOH A:735 , GLN A:349 , MET A:342 , PHE A:341	Neighbourhood of 1:B_LYS_688 _B_ILE_689 _B_LEU_690 _B_HIS_691 _B_ARG_692 _B_LEU_693 _B_LEU_694 _B_GLN_ 695 (Entity 2)
5	AC5	PSILO	GLN A:286 , HOH A:727 , MET A:365 , VAL A:361 , ARG A:364 , CYS A:285 , HOH A:725 , ARG A:367 , LEU A:292 , LEU A:287 , ALA A:368 , HOH A:724 , PHE A:377 , HOH A:733 , PHE A:378 , HIS A:323 , VAL A:376 , LEU A:324 , CYS A:320 , HIS A:479 , MET A:358 , ILE A:400 , PHE A:388 , PHE A:401 , SER A:404 , ILE A:397	Neighbourhood of 1:L_LIG_1 (Entity 3)
6	AC6	SOFTWARE	CYS A:285 , GLN A:286 , LEU A:287 , LEU A:292 , CYS A:320 , HIS A:323 , ARG A:364 , ARG A:367 , ALA A:368 , PHE A:377 , PHE A:378 , PHE A:388 , ILE A:400 , PHE A:401 , HOH A:724	binding site for residue 43V A 601
7	AC7	SOFTWARE	ARG A:310 , LYS A:469 , GLY A:470 , SO4 A:603	binding site for residue SO4 A 602
8	AC8	SOFTWARE	LYS A:311 , PRO A:468 , LYS A:469 , SO4 A:602	binding site for residue SO4 A 603

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:243
                                                                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhh....hhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh...ee....eeee..eeehhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4xt9 A 265 ASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFS 507
                                   274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504

Chain B from PDB  Type:PROTEIN  Length:8
                                        
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author .hhhhhhh Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE -------- PROSITE
                 Transcript -------- Transcript
                 4xt9 B 688 KILHRLLQ 695

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (37, 37)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		43V	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4xt9)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	4xt9
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RORG_HUMAN \| P51449
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description