Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  PORCINE HEAT-LABILE ENTEROTOXIN R13H IN COMPLEX WITH INHIBITOR MM146
 
Authors :  J. E. Heggelund, A. Mackenzie, U. Krengel
Date :  29 Sep 16  (Deposition) - 31 May 17  (Release) - 07 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B,C,D,E
Keywords :  Heat-Labile Enterotoxin, Inhibitor, Cholera, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. E. Heggelund, A. Mackenzie, T. Martinsen, J. Benjamin Heim, P. Cheshev, A. Bernardi, U. Krengel
Towards New Cholera Prophylactics And Treatment: Crystal Structures Of Bacterial Enterotoxins In Complex With Gm1 Mimics.
Sci Rep V. 7 2326 2017
PubMed-ID: 28539625  |  Reference-DOI: 10.1038/S41598-017-02179-0

(-) Compounds

Molecule 1 - HEAT-LABILE ENTEROTOXIN B CHAIN
    Chains: A, B, C, D, E
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Taxid: 469008
    Gene: ELTB, LTPB
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
    Synonym: LT-B,PORCINE,LTP-B

 Structural Features

(-) Chains, Units

  12345
Asymmetric/Biological Unit : ABCDE

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 12)

Asymmetric/Biological Unit (5, 12)
No.NameCountTypeFull Name
17BQ1Ligand/Ion(2~{R},4~{S},5~{R},6~{R})-5-ACETAMIDO-2-[4-[(2~{R})-3-[2-[(2~{S},3~{R},4~{R},5~{R},6~{R})-6-(HYDROXYMETHYL)-3,4,5-TRIS(OXIDANYL)OXAN-2-YL]ETHYLAMINO]-3-OXIDANYLIDENE-2-(2-PHENYLETHANOYLAMINO)PROPYL]-1,2,3-TRIAZOL-1-YL]-4-OXIDANYL-6-[(1~{R},2~{R})-1,2,3-TRIS(OXIDANYL)PROPYL]OXANE-2-CARBOXYLIC ACID
27DB4Ligand/Ion(2~{R},4~{S},5~{R},6~{R})-5-ACETAMIDO-2-[4-[(2~{S})-3-[2-[(2~{S},3~{R},4~{R},5~{R},6~{R})-6-(HYDROXYMETHYL)-3,4,5-TRIS(OXIDANYL)OXAN-2-YL]ETHYLAMINO]-3-OXIDANYLIDENE-2-(2-PHENYLETHANOYLAMINO)PROPYL]-1,2,3-TRIAZOL-1-YL]-4-OXIDANYL-6-[(1~{R},2~{R})-1,2,3-TRIS(OXIDANYL)PROPYL]OXANE-2-CARBOXYLIC ACID
3GOL5Ligand/IonGLYCEROL
4PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
5PO41Ligand/IonPHOSPHATE ION

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREALA A:1 , HOH A:364 , HOH A:415 , ARG B:35binding site for residue GOL A 201
02AC2SOFTWAREGLU A:11 , TYR A:12 , HIS A:13 , GLU A:51 , GLN A:56 , HIS A:57 , ILE A:58 , GLN A:61 , TRP A:88 , ASN A:90 , LYS A:91 , PEG A:203 , HOH A:304 , HOH A:306 , HOH A:311 , HOH A:321 , HOH A:324 , HOH A:330 , HOH A:344 , HOH A:355 , HOH A:358 , HOH A:396 , HOH A:420 , GLY B:33 , LYS B:34 , HOH B:361binding site for residue 7BQ A 202
03AC3SOFTWARE7BQ A:202 , HOH A:358binding site for residue PEG A 203
04AC4SOFTWAREHOH A:314 , TYR B:18 , GLU B:46 , THR B:47 , PRO B:93 , ASN B:94 , HOH B:382binding site for residue GOL B 201
05AC5SOFTWARETHR B:4 , ILE B:5 , THR B:6 , LYS B:84 , HOH B:301 , HOH B:309binding site for residue GOL B 202
06AC6SOFTWAREGLU B:51 , GLN B:56 , HIS B:57 , GLN B:61 , TRP B:88 , ASN B:90 , LYS B:91 , HOH B:303 , HOH B:304 , HOH B:332 , HOH B:337 , HOH B:369 , HOH B:374 , HOH B:375 , HOH B:384 , HOH B:408 , GLU C:11 , TYR C:12 , HIS C:13 , 7DB C:202 , HOH C:313 , HOH C:320 , HOH C:323 , HOH C:355 , HOH C:379 , LYS D:34binding site for residue 7DB B 203
07AC7SOFTWAREHOH B:346 , TYR C:18 , GLU C:46 , THR C:47 , PRO C:93 , ASN C:94 , HOH C:303 , HOH C:393 , THR E:15 , GLN E:16 , ASN E:89binding site for residue GOL C 201
08AC8SOFTWAREGLU B:11 , TYR B:12 , HIS B:13 , ASN B:14 , 7DB B:203 , HOH B:304 , HOH B:345 , HOH B:369 , HOH B:375 , HOH B:426 , GLY C:33 , ARG C:35 , GLU C:51 , SER C:55 , GLN C:56 , HIS C:57 , GLN C:61 , TRP C:88 , ASN C:90 , LYS C:91 , HOH C:310 , HOH C:313 , HOH C:314 , HOH C:320 , HOH C:322 , HOH C:323 , HOH C:324 , HOH C:372 , HOH C:379binding site for residue 7DB C 202
09AC9SOFTWAREHIS C:13 , ASN C:14 , HOH C:311 , HOH C:333 , HOH C:398 , HOH C:409 , LYS E:84 , HOH E:319binding site for residue PO4 C 203
10AD1SOFTWAREILE D:58 , ASP D:59 , LYS D:102 , HOH D:301 , HOH D:397 , HOH D:422 , LYS E:34binding site for residue GOL D 201
11AD2SOFTWARETHR A:4 , GLU A:7 , HOH A:325 , GLU D:11 , TYR D:12 , HIS D:13 , GLU D:51 , SER D:55 , GLN D:56 , GLN D:61 , TRP D:88 , ASN D:90 , LYS D:91 , HOH D:305 , HOH D:312 , HOH D:319 , HOH D:325 , HOH D:329 , HOH D:334 , HOH D:343 , HOH D:359 , HOH D:363 , HOH D:375 , HOH D:390 , HOH D:398 , GLY E:33 , LYS E:34binding site for residue 7DB D 202
12AD3SOFTWAREGLY A:33 , LYS A:34 , SER D:44 , GLY D:45 , GLU D:46 , GLU E:11 , TYR E:12 , HIS E:13 , GLU E:51 , GLN E:56 , HIS E:57 , GLN E:61 , TRP E:88 , ASN E:90 , LYS E:91 , HOH E:305 , HOH E:310 , HOH E:313 , HOH E:322 , HOH E:325 , HOH E:343 , HOH E:370 , HOH E:379 , HOH E:380 , HOH E:390 , HOH E:393 , HOH E:410binding site for residue 7DB E 201

(-) SS Bonds  (5, 5)

Asymmetric/Biological Unit
No.Residues
1A:9 -A:86
2B:9 -B:86
3C:9 -C:86
4D:9 -D:86
5E:9 -E:86

(-) Cis Peptide Bonds  (5, 6)

Asymmetric/Biological Unit
No.Residues
1Thr A:92 -Pro A:93
2Thr B:92 -Pro B:93
3Thr C:92 -Pro C:93
4Thr D:92 -Pro D:93
5Thr E:92 -Pro E:93

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5LZI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5LZI)

(-) Exons   (0, 0)

(no "Exon" information available for 5LZI)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh...eeeee......eeeee......eeeee.....eeee........hhhhhhhhhhhhhhhhhhhh.....eeeee......eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5lzi A   1 APQTITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain B from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh...eeeee......eeeee......eeeee.....eeee........hhhhhhhhhhhhhhhhhhh......eeeee......eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5lzi B   1 APQTITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain C from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh...eeeee......eeeee......eeeee.....eeee........hhhhhhhhhhhhhhhhhhh......eeeee......eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5lzi C   1 APQTITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain D from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh...eeeee......eeeee......eeeee.....eeee........hhhhhhhhhhhhhhhhhhh......eeeee......eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5lzi D   1 APQTITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain E from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh...eeeee......eeeee......eeeee.....eeee........hhhhhhhhhhhhhhhhhhh......eeeee......eeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5lzi E   1 APQTITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 103
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5LZI)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5LZI)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5LZI)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    7BQ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    7DB  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Thr A:92 - Pro A:93   [ RasMol ]  
    Thr B:92 - Pro B:93   [ RasMol ]  
    Thr C:92 - Pro C:93   [ RasMol ]  
    Thr D:92 - Pro D:93   [ RasMol ]  
    Thr E:92 - Pro E:93   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5lzi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ELBP_ECOLX | P32890
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ELBP_ECOLX | P32890
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ELBP_ECOLX | P32890: 1djr 1eef 1efi 1fd7 1htl 1jqy 1lt3 1lt4 1lt5 1lt6 1lta 1ltb 1ltg 1lti 1lts 1ltt 1pzi 1tet 2xrq 2xrs

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5LZI)