1LT5 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   HEAT-LABILE ENTEROTOXIN B-PENTAMER COMPLEXED WITH THIODIGALACTOSIDE

Authors :   E. A. Merritt, W. G. J. Hol

Date :   30 Sep 97 (Deposition) - 03 Dec 97 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.70

Chains :   Asym./Biol. Unit : D,E,F,G,H

Keywords :   Enterotoxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. A. Merritt, S. Sarfaty, I. K. Feil, W. G. Hol
Structural Foundation For The Design Of Receptor Antagonists Targeting Escherichia Coli Heat-Labile Enterotoxin.
Structure V. 5 1485 1997
PubMed-ID: 9384564 | Reference-DOI: 10.1016/S0969-2126(97)00298-0
(for further references see the PDB file header)

Molecule 1 - HEAT-LABILE ENTEROTOXIN
	Chains	:	D, E, F, G, H
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	MC1061
	Expression System Taxid	:	562
	Expression System Vector	:	PROFIT
	Fragment	:	B-PENTAMER
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562
	Strain	:	PORCINE
	Synonym	:	LT-I

		1	2	3	4	5
Asymmetric/Biological Unit	:	D	E	F	G	H

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 5)

No.	Name	Count	Type	Full Name
1	TDG	5	Ligand/Ion	THIODIGALACTOSIDE

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TYR D:12 , GLU D:51 , GLN D:56 , HIS D:57 , GLN D:61 , TRP D:88 , ASN D:90 , LYS D:91 , HOH D:175 , HOH D:176 , HOH D:177 , HOH D:178 , HOH D:180 , HOH E:181	BINDING SITE FOR RESIDUE TDG D 104
2	AC2	SOFTWARE	TYR E:12 , GLU E:51 , GLN E:56 , HIS E:57 , GLN E:61 , TRP E:88 , ASN E:90 , LYS E:91 , HOH E:131 , HOH E:141 , HOH E:143 , HOH E:156 , HOH E:174 , LYS F:43 , HOH F:121	BINDING SITE FOR RESIDUE TDG E 104
3	AC3	SOFTWARE	TYR F:12 , GLU F:51 , GLN F:56 , HIS F:57 , GLN F:61 , TRP F:88 , ASN F:90 , LYS F:91 , HOH F:108 , HOH F:110 , HOH F:124 , HOH F:158 , HOH F:160 , HOH G:114	BINDING SITE FOR RESIDUE TDG F 104
4	AC4	SOFTWARE	TYR G:12 , GLU G:51 , GLN G:56 , HIS G:57 , GLN G:61 , TRP G:88 , ASN G:90 , LYS G:91 , HOH G:128 , HOH G:130 , HOH G:138 , HOH G:152 , HOH G:167 , HOH G:171 , HOH H:126	BINDING SITE FOR RESIDUE TDG G 104
5	AC5	SOFTWARE	HOH D:112 , TYR H:12 , GLU H:51 , GLN H:56 , HIS H:57 , GLN H:61 , TRP H:88 , ASN H:90 , LYS H:91 , HOH H:110 , HOH H:111 , HOH H:112 , HOH H:138 , HOH H:156	BINDING SITE FOR RESIDUE TDG H 104

Asymmetric/Biological Unit

No.	Residues
1	D:9	-	D:86
2	E:9	-	E:86
3	F:9	-	F:86
4	G:9	-	G:86
5	H:9	-	H:86

Asymmetric/Biological Unit

No.	Residues
1	Thr D:92	-	Pro D:93
2	Thr E:92	-	Pro E:93
3	Thr F:92	-	Pro F:93
4	Thr G:92	-	Pro G:93
5	Thr H:92	-	Pro H:93

Asymmetric/Biological Unit (1, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_ELBP_ECOLX_001 *	T	96	A	ELBP_ECOLX	---	---	D/E/F/G/H	T	75	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1LT5)

(no "Exon" information available for 1LT5)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain D from PDB  Type:PROTEIN  Length:103
 aligned with ELBP_ECOLX | P32890 from UniProtKB/Swiss-Prot  Length:124

    Alignment length:103
                                    31        41        51        61        71        81        91       101       111       121   
           ELBP_ECOLX    22 APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 124
               SCOP domains d1lt5d_ D: Heat-labile toxin                                                                            SCOP domains
               CATH domains 1lt5D00 D:1-103  [code=2.40.50.110, no name defined]                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh...eeeee......eeeeeee..eeeeeee.....eeee........hhhhhhhhhhhhhhhhhhh......eeeee......eeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------A---------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 1lt5 D   1 APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 103
                                    10        20        30        40        50        60        70        80        90       100

Chain E from PDB  Type:PROTEIN  Length:103
 aligned with ELBP_ECOLX | P32890 from UniProtKB/Swiss-Prot  Length:124

    Alignment length:103
                                    31        41        51        61        71        81        91       101       111       121   
           ELBP_ECOLX    22 APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 124
               SCOP domains d1lt5e_ E: Heat-labile toxin                                                                            SCOP domains
               CATH domains 1lt5E00 E:1-103  [code=2.40.50.110, no name defined]                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh...eeeee......eeeee......eeeee.....eeee........hhhhhhhhhhhhhhhhhhh......eeeee......eeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------A---------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 1lt5 E   1 APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 103
                                    10        20        30        40        50        60        70        80        90       100

Chain F from PDB  Type:PROTEIN  Length:103
 aligned with ELBP_ECOLX | P32890 from UniProtKB/Swiss-Prot  Length:124

    Alignment length:103
                                    31        41        51        61        71        81        91       101       111       121   
           ELBP_ECOLX    22 APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 124
               SCOP domains d1lt5f_ F: Heat-labile toxin                                                                            SCOP domains
               CATH domains 1lt5F00 F:1-103  [code=2.40.50.110, no name defined]                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh...eeeee......eeeee......eeeee.....eeee........hhhhhhhhhhhhhhhhhhh....eeeeeee.........eeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------A---------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 1lt5 F   1 APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 103
                                    10        20        30        40        50        60        70        80        90       100

Chain G from PDB  Type:PROTEIN  Length:103
 aligned with ELBP_ECOLX | P32890 from UniProtKB/Swiss-Prot  Length:124

    Alignment length:103
                                    31        41        51        61        71        81        91       101       111       121   
           ELBP_ECOLX    22 APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 124
               SCOP domains d1lt5g_ G: Heat-labile toxin                                                                            SCOP domains
               CATH domains 1lt5G00 G:1-103  [code=2.40.50.110, no name defined]                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh...eeeee......eeeee......eeeee.....eeee........hhhhhhhhhhhhhhhhhhh......eeeee......eeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------A---------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 1lt5 G   1 APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 103
                                    10        20        30        40        50        60        70        80        90       100

Chain H from PDB  Type:PROTEIN  Length:103
 aligned with ELBP_ECOLX | P32890 from UniProtKB/Swiss-Prot  Length:124

    Alignment length:103
                                    31        41        51        61        71        81        91       101       111       121   
           ELBP_ECOLX    22 APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 124
               SCOP domains d1lt5h_ H: Heat-labile toxin                                                                            SCOP domains
               CATH domains 1lt5H00 H:1-103  [code=2.40.50.110, no name defined]                                                    CATH domains
           Pfam domains (1) Enterotoxin_b-1lt5H01 H:1-102                                                                         - Pfam domains (1)
           Pfam domains (2) Enterotoxin_b-1lt5H02 H:1-102                                                                         - Pfam domains (2)
           Pfam domains (3) Enterotoxin_b-1lt5H03 H:1-102                                                                         - Pfam domains (3)
           Pfam domains (4) Enterotoxin_b-1lt5H04 H:1-102                                                                         - Pfam domains (4)
           Pfam domains (5) Enterotoxin_b-1lt5H05 H:1-102                                                                         - Pfam domains (5)
         Sec.struct. author ....hhhhhhh...eeeee......eeeeeee..eeeeeee.....eeee........hhhhhhhhhhhhhhhhhhh......eeeee......eeeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------A---------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 1lt5 H   1 APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN 103
                                    10        20        30        40        50        60        70        80        90       100

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: OB-fold (1179)

Superfamily: Bacterial enterotoxins (188)

Family: Bacterial AB5 toxins, B-subunits (85)

Protein domain: Heat-labile toxin (24)

Escherichia coli, type IB [TaxId: 562] (21)

1a	d1lt5d_	D:
1b	d1lt5e_	E:
1c	d1lt5f_	F:
1d	d1lt5g_	G:
1e	d1lt5h_	H:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Beta Barrel (4804)

Topology: OB fold (Dihydrolipoamide Acetyltransferase, E2P) (1040)

Homologous Superfamily: [code=2.40.50.110, no name defined] (136)

Escherichia coli. Organism_taxid: 562. Strain: porcine. (7)

1a	1lt5D00	D:1-103
1b	1lt5E00	E:1-103
1c	1lt5F00	F:1-103
1d	1lt5G00	G:1-103
1e	1lt5H00	H:1-103

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Enterotoxin_b] (23)

Family: Enterotoxin_b (23)

Escherichia coli (12)

1a	Enterotoxin_b-1lt5H01	H:1-102
1b	Enterotoxin_b-1lt5H02	H:1-102
1c	Enterotoxin_b-1lt5H03	H:1-102
1d	Enterotoxin_b-1lt5H04	H:1-102
1e	Enterotoxin_b-1lt5H05	H:1-102

Asymmetric/Biological Unit(hide GO term definitions)

Chain D,E,F,G,H (ELBP_ECOLX | P32890)

biological process
	GO:0031640	killing of cells of other organism	Any process in an organism that results in the killing of cells of another organism, including in some cases the death of the other organism. Killing here refers to the induction of death in one cell by another cell, not cell-autonomous death due to internal or other environmental conditions.
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		TDG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Thr D:92 - Pro D:93	[ RasMol ]
		Thr E:92 - Pro E:93	[ RasMol ]
		Thr F:92 - Pro F:93	[ RasMol ]
		Thr G:92 - Pro G:93	[ RasMol ]
		Thr H:92 - Pro H:93	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1lt5
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ELBP_ECOLX \| P32890
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ELBP_ECOLX \| P32890
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1LT5)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 5)

Sites (5, 5)

SS Bonds (5, 5)

Cis Peptide Bonds (5, 5)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 5)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 5)

CATH Domains (1, 5)

Pfam Domains (1, 5)

Gene Ontology (3, 3)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File