Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE BILIVERDIN REDUCTASE RV2074 FROM MYCOBACTERIUM TUBERCULOSIS IN COMPLEX WITH F420
 
Authors :  F. H. Ahmed, P. D. Carr, C. J. Jackson
Date :  12 Apr 16  (Deposition) - 13 Jul 16  (Release) - 31 Aug 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Biliverdin Reductase, Split Beta-Barrel Fold, Flavin/Deazaflavin Oxidoreductase, F420 Binding Protein, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  F. H. Ahmed, A. E. Mohamed, P. D. Carr, B. M. Lee, K. Condic-Jurkic, M. L. O'Mara, C. J. Jackson
Rv2074 Is A Novel F420 H2 -Dependent Biliverdin Reductase I Mycobacterium Tuberculosis.
Protein Sci. V. 25 1692 2016
PubMed-ID: 27364382  |  Reference-DOI: 10.1002/PRO.2975

(-) Compounds

Molecule 1 - BILIVERDIN REDUCTASE RV2074
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: RV2074, MTCY49.13
    Organism Scientific: MYCOBACTERIUM TUBERCULOSIS (STRAIN ATCC 25618 / H37RV)
    Organism Taxid: 83332
    Strain: ATCC 25618 / H37RV

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric Unit (2, 8)
No.NameCountTypeFull Name
16J44Ligand/IonCOENZYME F420-3
2CL4Ligand/IonCHLORIDE ION
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
16J42Ligand/IonCOENZYME F420-3
2CL-1Ligand/IonCHLORIDE ION
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
16J42Ligand/IonCOENZYME F420-3
2CL-1Ligand/IonCHLORIDE ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:36 , VAL A:38 , ALA A:39 , VAL A:40 , GLY A:41 , ILE A:54 , THR A:55 , GLY A:58 , GLN A:60 , LYS A:61 , ARG A:67 , HOH A:327 , HOH A:330 , HOH A:332 , HOH A:342 , HOH A:351 , HOH A:358 , HOH A:368 , HOH A:391 , HOH A:406 , HOH A:408 , HOH A:415 , HOH A:417 , ARG B:9 , GLY B:78 , ALA B:79 , TRP B:81 , ARG B:126binding site for residue 6J4 A 201
2AC2SOFTWARETHR A:55 , ASN A:114 , ARG A:117binding site for residue CL A 202
3AC3SOFTWAREMET A:1 , GLY A:78 , ALA A:79 , TRP A:81 , HIS B:36 , VAL B:38 , ALA B:39 , VAL B:40 , GLY B:41 , ILE B:54 , THR B:55 , GLY B:58 , GLN B:60 , LYS B:61 , ARG B:67 , HOH B:306 , HOH B:310 , HOH B:317 , HOH B:322 , HOH B:324 , HOH B:329 , HOH B:330 , HOH B:362 , HOH B:364 , HOH B:383 , HOH B:392binding site for residue 6J4 B 201
4AC4SOFTWARETHR B:55 , ASN B:114 , ARG B:117 , HOH B:352binding site for residue CL B 202
5AC5SOFTWAREHIS C:36 , VAL C:38 , ALA C:39 , VAL C:40 , GLY C:41 , ILE C:54 , THR C:55 , GLY C:58 , SER C:59 , GLN C:60 , LYS C:61 , ARG C:67 , HOH C:326 , HOH C:330 , HOH C:343 , HOH C:349 , HOH C:351 , HOH C:360 , HOH C:363 , HOH C:366 , HOH C:370 , HOH C:378 , HOH C:381 , HOH C:401 , GLY D:78 , ALA D:79 , TRP D:81 , ARG D:126 , LEU D:128binding site for residue 6J4 C 201
6AC6SOFTWARETHR C:55 , ASN C:114 , ARG C:117binding site for residue CL C 202
7AC7SOFTWAREGLY C:78 , ALA C:79 , TRP C:81 , ARG C:126 , LEU C:128 , HIS D:36 , VAL D:38 , ALA D:39 , VAL D:40 , GLY D:41 , ILE D:54 , THR D:55 , GLY D:58 , GLN D:60 , LYS D:61 , ARG D:67 , HOH D:305 , HOH D:313 , HOH D:319 , HOH D:320 , HOH D:322 , HOH D:328 , HOH D:330 , HOH D:354 , HOH D:365 , HOH D:366 , HOH D:370 , HOH D:379 , HOH D:388binding site for residue 6J4 D 201
8AC8SOFTWARETHR D:55 , ASN D:114 , ARG D:117binding site for residue CL D 202

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5JAB)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5JAB)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5JAB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5JAB)

(-) Exons   (0, 0)

(no "Exon" information available for 5JAB)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:135
                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.......hhhhhhhhhh...eeeeee.....eeeeee..eee....eeeeeee..hhhhhhhhhhheeeeeeee..eeeeeeeeeeee.hhhhhhhhhhhhhhhh........eeeeeeeeeeeee.hhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jab A   1 MAMVNTTTRLSDDALAFLSERHLAMLTTLRADNSPHVVAVGFTFDPKTHIARVITTGGSQKAVNADRSGLAVLSQVDGARWLSLEGRAAVNSDIDAVRDAELRYAQRYRTPRPNPRRVVIEVQIERVLGSADLLD 135
                                    10        20        30        40        50        60        70        80        90       100       110       120       130     


Chain B from PDB  Type:PROTEIN  Length:127
                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh...eeeeee.....eeeeee..eee....eeeeeee..hhhhhhhhhhheeeeeeee..eeeeeeeeeeee.hhhhhhhhhhhhhhhh........eeeeeeeeeeeee.hhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jab B   9 RLSDDALAFLSERHLAMLTTLRADNSPHVVAVGFTFDPKTHIARVITTGGSQKAVNADRSGLAVLSQVDGARWLSLEGRAAVNSDIDAVRDAELRYAQRYRTPRPNPRRVVIEVQIERVLGSADLLD 135
                                    18        28        38        48        58        68        78        88        98       108       118       128       


Chain C from PDB  Type:PROTEIN  Length:127
                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh...eeeeee.....eeeeee..eee....eeeeeee..hhhhhhhhhhheeeeeeee..eeeeeeeeeeee.hhhhhhhhhhhhhhhh........eeeeeeeeeeeee.hhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jab C   9 RLSDDALAFLSERHLAMLTTLRADNSPHVVAVGFTFDPKTHIARVITTGGSQKAVNADRSGLAVLSQVDGARWLSLEGRAAVNSDIDAVRDAELRYAQRYRTPRPNPRRVVIEVQIERVLGSADLLD 135
                                    18        28        38        48        58        68        78        88        98       108       118       128       


Chain D from PDB  Type:PROTEIN  Length:134
                                                                                                                                                                      
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhh...eeeeee.....eeeeee..eee....eeeeeee..hhhhhhhhhhheeeeeeee..eeeeeeeeeeee.hhhhhhhhhhhhhhhh........eeeeeeeeeeeeehhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jab D   2 AMVNTTTRLSDDALAFLSERHLAMLTTLRADNSPHVVAVGFTFDPKTHIARVITTGGSQKAVNADRSGLAVLSQVDGARWLSLEGRAAVNSDIDAVRDAELRYAQRYRTPRPNPRRVVIEVQIERVLGSADLLD 135
                                    11        21        31        41        51        61        71        81        91       101       111       121       131
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5JAB)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5JAB)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5JAB)

(-) Gene Ontology  (8, 8)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6J4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5jab)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5jab
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FBVR_MYCTU | P9WLL7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FBVR_MYCTU | P9WLL7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FBVR_MYCTU | P9WLL7: 2asf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5JAB)