Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PA14 DOMAIN OF MPAFP ANTIFREEZE PROTEIN
 
Authors :  S. Guo
Date :  05 Apr 16  (Deposition) - 07 Jun 17  (Release) - 07 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.03
Chains :  Asym./Biol. Unit :  A
Keywords :  Cell Adhesion, Sugar Binding, Antifreeze Protein, Pa14 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Guo, P. Davies, R. Campbell
Pa14 Domain Of Mpafp
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - ANTIFREEZE PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: MARINOMONAS PRIMORYENSIS
    Organism Taxid: 178399

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 10)

Asymmetric/Biological Unit (3, 10)
No.NameCountTypeFull Name
1BGC1Ligand/IonBETA-D-GLUCOSE
2CA8Ligand/IonCALCIUM ION
3GLC1Ligand/IonALPHA-D-GLUCOSE

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:110 , ASP A:111 , ASP A:155 , GLY A:157 , ASP A:159 , GLC A:309 , BGC A:310binding site for residue CA A 301
2AC2SOFTWAREGLN A:27 , ASP A:87 , GLN A:156 , HOH A:476 , HOH A:609 , HOH A:628binding site for residue CA A 302
3AC3SOFTWARESER A:73 , SER A:76 , HOH A:502 , HOH A:526 , HOH A:550 , HOH A:552 , HOH A:630 , HOH A:645binding site for residue CA A 303
4AC4SOFTWAREGLY A:64 , ASP A:81 , PRO A:82 , HOH A:444 , HOH A:512 , HOH A:527 , HOH A:538binding site for residue CA A 304
5AC5SOFTWAREGLN A:5 , ASP A:7 , THR A:9 , ASP A:11 , HOH A:408 , HOH A:414binding site for residue CA A 305
6AC6SOFTWARETYR A:22 , VAL A:38 , LYS A:41 , HOH A:625 , HOH A:627 , HOH A:640binding site for residue CA A 306
7AC7SOFTWAREHOH A:467 , HOH A:472 , HOH A:534 , HOH A:576 , HOH A:610 , HOH A:653 , HOH A:656 , HOH A:681binding site for residue CA A 307
8AC8SOFTWARESER A:172 , HOH A:464 , HOH A:486 , HOH A:508 , HOH A:522 , HOH A:659 , HOH A:668binding site for residue CA A 308
9AC9SOFTWAREASP A:110 , ASP A:111 , GLN A:156 , GLY A:157 , ASP A:159 , CA A:301 , HOH A:406 , HOH A:517binding site for Poly-Saccharide residues GLC A 309 through BGC A 310

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5J6Y)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Gly A:55 -Arg A:56
2Asp A:110 -Asp A:111

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5J6Y)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5J6Y)

(-) Exons   (0, 0)

(no "Exon" information available for 5J6Y)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:188
                                                                                                                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............eeeeeeee.....hhhhhhhhhhhh...eeeee....eeee.......hhhhhhhhhhhhhh........eeeeeeeeeeee..eeeeeeeeee..eeeee..eeeeee......eeee...eee...eeeeeeeeeee....eeeeeeee..............ee........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j6y A   4 AQDDSTPDSLFAGLVGEYYGTNSQLNNISDFRALVDSKEADATFEAANISYGRGSSDVAKGTHLQEFLGSDASTLSTDPGDNTDGGIYLQGYVYLEAGTYNFKVTADDGYEITINGNPVATVDNNQSVYTVTHASFTISESGYQAIDMIWWDQGGDYVFQPTLSADGGSTYFVLDSAILSSTGETPYT 191
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5J6Y)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5J6Y)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5J6Y)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BGC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp A:110 - Asp A:111   [ RasMol ]  
    Gly A:55 - Arg A:56   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5j6y
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A1YIY3_9GAMM | A1YIY3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A1YIY3_9GAMM | A1YIY3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A1YIY3_9GAMM | A1YIY3: 3p4g 4kdv 4kdw

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5J6Y)