Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF TETRAMERIC JACALIN COMPLEXED WITH GAL ALPHA-(1,4) GAL
 
Authors :  K. V. Abhinav, K. Sharma, A. Surolia, M. Vijayan
Date :  01 Apr 16  (Deposition) - 14 Dec 16  (Release) - 14 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.67
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  E,F,G,H  (1x)
Keywords :  Plant Lectins, Sugar Binding Protein, Galactose Specific Lectin, Beta-Prism I Fold, Post Translational Proteolysis, T-Antigen Binding Protein, Reducing, Non-Reducing Sugars (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. V. Abhinav, K. Sharma, A. Surolia, M. Vijayan
Effect Of Linkage On The Location Of Reducing And Nonreducing Sugars Bound To Jacalin.
Iubmb Life V. 68 971 2016
PubMed-ID: 27808459  |  Reference-DOI: 10.1002/IUB.1572

(-) Compounds

Molecule 1 - AGGLUTININ ALPHA CHAIN
    Chains: A, C, E, G
    Organism Common: JACK FRUIT
    Organism Scientific: ARTOCARPUS INTEGER
    Organism Taxid: 3490
    Synonym: JACALIN ALPHA CHAIN
 
Molecule 2 - AGGLUTININ BETA-3 CHAIN
    Chains: B, D, F, H
    Organism Common: JACK FRUIT
    Organism Scientific: ARTOCARPUS INTEGER
    Organism Taxid: 3490
    Synonym: JACALIN BETA-3 CHAIN

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDEFGH
Biological Unit 1 (1x): ABCD    
Biological Unit 2 (1x):     EFGH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 39)

Asymmetric Unit (4, 39)
No.NameCountTypeFull Name
1EDO28Ligand/Ion1,2-ETHANEDIOL
2GLA4Ligand/IonALPHA D-GALACTOSE
3IPA6Ligand/IonISOPROPYL ALCOHOL
4PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
Biological Unit 1 (3, 19)
No.NameCountTypeFull Name
1EDO13Ligand/Ion1,2-ETHANEDIOL
2GLA-1Ligand/IonALPHA D-GALACTOSE
3IPA5Ligand/IonISOPROPYL ALCOHOL
4PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
Biological Unit 2 (3, 20)
No.NameCountTypeFull Name
1EDO15Ligand/Ion1,2-ETHANEDIOL
2GLA4Ligand/IonALPHA D-GALACTOSE
3IPA1Ligand/IonISOPROPYL ALCOHOL
4PEG-1Ligand/IonDI(HYDROXYETHYL)ETHER

(-) Sites  (37, 37)

Asymmetric Unit (37, 37)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREALA A:3 , PHE A:4 , LYS A:117 , GLY A:118 , TYR A:126binding site for residue EDO A 201
02AC2SOFTWAREASN A:16 , ASN A:43binding site for residue EDO A 202
03AC3SOFTWARESER A:46 , PHE A:47 , THR A:49binding site for residue EDO A 203
04AC4SOFTWAREIPA A:205 , THR C:23 , SER C:76 , TRP C:123binding site for residue IPA A 204
05AC5SOFTWAREIPA A:204 , SER C:76 , TRP C:123 , IPA C:211binding site for residue IPA A 205
06AC6SOFTWAREARG A:13binding site for residue IPA A 206
07AC7SOFTWARETYR A:78 , VAL A:80 , GLY A:121 , TYR A:122 , TRP A:123 , ASP A:125 , HOH A:345 , HOH A:393binding site for residue PEG A 207
08AC8SOFTWAREHOH B:204binding site for residue IPA B 101
09AC9SOFTWAREGLN B:8 , ASN C:110 , LEU C:112 , LEU C:133 , EDO C:202binding site for residue EDO C 201
10AD1SOFTWARETYR C:64 , ASN C:110 , GLY C:111 , LEU C:112 , EDO C:201 , SER H:4binding site for residue EDO C 202
11AD2SOFTWARETYR C:64binding site for residue EDO C 203
12AD3SOFTWAREPHE C:4 , ASP C:5 , ASP C:6 , GLN C:42 , HIS C:44binding site for residue EDO C 204
13AD4SOFTWAREASP C:27 , ASN C:43 , LYS C:45 , PRO C:53 , HOH C:320 , VAL E:40 , EDO E:206binding site for residue EDO C 205
14AD5SOFTWARETYR C:19 , LYS C:21 , THR C:52 , HOH C:312binding site for residue EDO C 206
15AD6SOFTWAREPRO E:53binding site for residue EDO C 207
16AD7SOFTWAREGLN C:42 , ASN C:43 , GLN E:42 , ASN E:43binding site for residue EDO C 208
17AD8SOFTWARELYS C:55 , TYR C:96binding site for residue EDO C 209
18AD9SOFTWAREHOH C:310binding site for residue EDO C 210
19AE1SOFTWAREGLU A:14 , LYS A:55 , IPA A:205binding site for residue IPA C 211
20AE2SOFTWAREALA A:8 , THR A:10 , ALA E:8 , THR E:10binding site for residue EDO E 201
21AE3SOFTWAREGLY E:1 , ALA E:3 , SER E:119 , TYR E:126binding site for residue EDO E 202
22AE4SOFTWARELYS C:55 , HOH C:303 , GLU E:14 , VAL E:31 , HOH E:303 , HOH E:338binding site for residue EDO E 203
23AE5SOFTWAREVAL C:40 , HOH C:354 , LEU E:17 , ASP E:27 , ASN E:43 , PRO E:53 , HOH E:335binding site for residue EDO E 204
24AE6SOFTWAREARG E:13 , PHE E:60 , HOH E:306 , HOH E:321binding site for residue EDO E 205
25AE7SOFTWAREASP C:27 , LYS C:45 , EDO C:205 , HOH C:346 , VAL E:40binding site for residue EDO E 206
26AE8SOFTWAREPHE E:51 , THR E:52 , HOH E:391 , TYR G:39binding site for residue EDO E 207
27AE9SOFTWAREASP A:6 , PHE A:9 , TYR A:39 , LEU E:34 , ASN E:35 , SER E:37 , EDO E:210binding site for residue EDO E 208
28AF1SOFTWAREGLY E:73 , ASN E:74 , ARG E:82 , SER E:100binding site for residue EDO E 209
29AF2SOFTWAREPHE C:51 , PRO C:53 , SER E:37 , EDO E:208binding site for residue EDO E 210
30AF3SOFTWARESER E:132 , LEU E:133 , HOH E:337 , HOH E:374 , LEU G:133binding site for residue EDO E 211
31AF4SOFTWARESER B:4 , TYR E:64 , ASN E:110 , GLY E:111 , LEU E:112 , HOH E:333binding site for residue IPA E 212
32AF5SOFTWAREALA C:8 , THR C:10 , ALA G:8 , PHE G:9 , THR G:10 , HOH G:357 , HOH G:374binding site for residue EDO G 201
33AF6SOFTWARELYS G:55 , HOH G:324binding site for residue EDO G 202
34AF7SOFTWAREGLY G:73 , ASN G:74 , ARG G:82 , SER G:100binding site for residue EDO G 203
35AF8SOFTWAREGLN D:3 , SER D:4 , TYR G:64 , ASN G:110 , GLY G:111binding site for residue EDO G 204
36AF9SOFTWAREGLY E:1 , SER E:76 , TYR E:78 , GLY E:121 , TYR E:122 , TRP E:123 , ASP E:125 , HOH E:304 , HOH E:340binding site for Poly-Saccharide residues GLA E 213 through GLA E 214
37AG1SOFTWAREGLY C:1 , TYR C:78 , VAL C:79 , ASP C:125 , HOH C:331 , HOH C:362 , GLY G:1 , SER G:76 , TYR G:78 , GLY G:121 , TYR G:122 , TRP G:123 , ASP G:125 , HOH G:366 , HOH G:371binding site for Poly-Saccharide residues GLA G 205 through GLA G 206

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5J51)

(-) Cis Peptide Bonds  (12, 12)

Asymmetric Unit
No.Residues
1Phe A:60 -Pro A:61
2Gly A:94 -Pro A:95
3Gly B:13 -Pro B:14
4Phe C:60 -Pro C:61
5Gly C:94 -Pro C:95
6Gly D:13 -Pro D:14
7Phe E:60 -Pro E:61
8Gly E:94 -Pro E:95
9Gly F:13 -Pro F:14
10Phe G:60 -Pro G:61
11Gly G:94 -Pro G:95
12Gly H:13 -Pro H:14

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5J51)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5J51)

(-) Exons   (0, 0)

(no "Exon" information available for 5J51)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:133
                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.....eeeeeeeee.....eeeeeeeeee..eeee...........eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eeeeeeeee.eeeeeeeee...eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j51 A   1 GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL 133
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   


Chain B from PDB  Type:PROTEIN  Length:15
                                               
               SCOP domains --------------- SCOP domains
               CATH domains --------------- CATH domains
               Pfam domains --------------- Pfam domains
         Sec.struct. author ......eeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------- SAPs(SNPs)
                    PROSITE --------------- PROSITE
                 Transcript --------------- Transcript
                 5j51 B   4 SGISQTVIVGPWGAK  18
                                    13     


Chain C from PDB  Type:PROTEIN  Length:133
                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.....eeeeeeeee.....eeeeeeeeee..eeeeeeee.......eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eeeeeeeee.eeeeeeeee...eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j51 C   1 GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL 133
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   


Chain D from PDB  Type:PROTEIN  Length:15
                                               
               SCOP domains --------------- SCOP domains
               CATH domains --------------- CATH domains
               Pfam domains --------------- Pfam domains
         Sec.struct. author .......eeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------- SAPs(SNPs)
                    PROSITE --------------- PROSITE
                 Transcript --------------- Transcript
                 5j51 D   3 QSGISQTVIVGPWGA  17
                                    12     


Chain E from PDB  Type:PROTEIN  Length:133
                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.....eeeeeeeee.....eeeeeeeeee..eeeeeeee.......eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeeee....eeeeeeeee.eeeeeeeee...eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j51 E   1 GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL 133
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   


Chain F from PDB  Type:PROTEIN  Length:15
                                               
               SCOP domains --------------- SCOP domains
               CATH domains --------------- CATH domains
               Pfam domains --------------- Pfam domains
         Sec.struct. author ......eeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------- SAPs(SNPs)
                    PROSITE --------------- PROSITE
                 Transcript --------------- Transcript
                 5j51 F   4 SGISQTVIVGPWGAK  18
                                    13     


Chain G from PDB  Type:PROTEIN  Length:133
                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.....eeeeeeeee.....eeeeeeeeee..eeee...........eeeeee.......eeeeeeeeeee..eeeeeeeeeee...eeeee.....eeeeeeeee.eeeeeeeee...eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5j51 G   1 GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL 133
                                    10        20        30        40        50        60        70        80        90       100       110       120       130   


Chain H from PDB  Type:PROTEIN  Length:15
                                               
               SCOP domains --------------- SCOP domains
               CATH domains --------------- CATH domains
               Pfam domains --------------- Pfam domains
         Sec.struct. author ......eeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------- SAPs(SNPs)
                    PROSITE --------------- PROSITE
                 Transcript --------------- Transcript
                 5j51 H   4 SGISQTVIVGPWGAK  18
                                    13
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5J51)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5J51)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5J51)

(-) Gene Ontology  (4, 8)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GLA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IPA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:94 - Pro A:95   [ RasMol ]  
    Gly B:13 - Pro B:14   [ RasMol ]  
    Gly C:94 - Pro C:95   [ RasMol ]  
    Gly D:13 - Pro D:14   [ RasMol ]  
    Gly E:94 - Pro E:95   [ RasMol ]  
    Gly F:13 - Pro F:14   [ RasMol ]  
    Gly G:94 - Pro G:95   [ RasMol ]  
    Gly H:13 - Pro H:14   [ RasMol ]  
    Phe A:60 - Pro A:61   [ RasMol ]  
    Phe C:60 - Pro C:61   [ RasMol ]  
    Phe E:60 - Pro E:61   [ RasMol ]  
    Phe G:60 - Pro G:61   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5j51
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LECA_ARTIN | P18670
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  LECB3_ARTIN | P18673
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  LECA_ARTIN | P18670
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  LECB3_ARTIN | P18673
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LECA_ARTIN | P18670: 1jac 1ku8 1kuj 1m26 1pxd 1toq 1tp8 1ugw 1ugx 1ugy 1uh0 1uh1 1ws4 1ws5 4ak4 4akb 4akc 4r6n 4r6o 4r6p 4r6q 4r6r 5j4t 5j4x 5j50 5jm1
        LECB3_ARTIN | P18673: 1m26 1pxd 1toq 1tp8 1ugw 1ugx 1ugy 1uh0 1uh1 1ws4 1ws5 4r6n 4r6o 4r6p 4r6q 4r6r 5j4t 5j4x 5j50 5jm1

(-) Related Entries Specified in the PDB File

1jac 1ku8 1kuj 1m26 1ugw 1ugx 1ugy 1uh0 1uh1 1ws4 1ws5 4r6n 4r6o 4r6p 4r6q 4r6r 5j4x 5j50 5j52