Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HIV PROTEASE COMPLEXED WITH [(1S)-1-[(S)-(4-CHLOROPHENYL)-(3,5-DIFLUOROPHENYL)METHYL]-2-[[5-FLUORO-4-[2-[(2R,5S)-5-(2,2,2-TRIFLUOROETHYLCARBAMOYLOXYMETHYL)MORPHOLIN-4-IUM-2-YL]ETHYL]PYRIDIN-1-IUM-3-YL]AMINO]-2-OXO-ETHYL]AMMONIUM
 
Authors :  H. P. Su
Date :  21 Mar 16  (Deposition) - 18 May 16  (Release) - 10 Aug 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.15
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Hiv, Protease, Hydrolase-Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. J. Bungard, P. D. Williams, J. E. Ballard, D. J. Bennett, C. Beaulieu C. Bahnck-Teets, S. S. Carroll, R. K. Chang, D. C. Dubost, J. F. Fay, T. L. Diamond, T. J. Greshock, L. Hao, M. K. Holloway, P. J. Felock, J. J. Gesell, H. P. Su, J. J. Manikowski, D. J. Mckay, M. Miller, X. Min, C. Molinaro, O. M. Moradei, P. G. Nantermet, C. Nadeau, R. I. Sanchez, T. Satyanarayana, W. D. Shipe, S. K. Singh, V. L. Truong, S. Vijayasaradhi, C. M. Wiscount, J. P. Vacca, S. N. Crane, J. A. Mccauley
Discovery Of Mk-8718, An Hiv Protease Inhibitor Containing Novel Morpholine Aspartate Binding Group.
Acs Med. Chem. Lett. V. 7 702 2016
PubMed-ID: 27437081  |  Reference-DOI: 10.1021/ACSMEDCHEMLETT.6B00135

(-) Compounds

Molecule 1 - PROTEASE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: POL
    Mutation: YES
    Organism Scientific: HUMAN IMMUNODEFICIENCY VIRUS 1
    Organism Taxid: 11676

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 6)

Asymmetric/Biological Unit (3, 6)
No.NameCountTypeFull Name
16EE2Ligand/Ion(BETAS)-4-CHLORO-BETA-(3,5-DIFLUOROPHENYL)-N-(5-FLUORO-4-{2-[(2R,5S)-5-({[(2,2,2-TRIFLUOROETHYL)CARBAMOYL]OXY}METHYL)MORPHOLIN-2-YL]ETHYL}PYRIDIN-3-YL)-L-PHENYLALANINAMIDE
2ACT2Ligand/IonACETATE ION
3CL2Ligand/IonCHLORIDE ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:28 , ASP A:29 , ASP A:30 , ILE A:47 , 6EE A:102 , 6EE B:101binding site for residue ACT A 101
2AC2SOFTWAREARG A:8 , LEU A:23 , ASP A:25 , GLY A:27 , ALA A:28 , ASP A:29 , ASP A:30 , VAL A:32 , GLY A:48 , GLY A:49 , ILE A:50 , VAL A:82 , ILE A:84 , ACT A:101 , HOH A:225 , ARG B:8 , LEU B:23 , ASP B:25 , GLY B:27 , GLY B:48 , GLY B:49 , ILE B:50 , PRO B:81 , ILE B:84 , 6EE B:101 , ACT B:102 , HOH B:203 , HOH B:228 , HOH B:242 , HOH B:303binding site for residue 6EE A 102
3AC3SOFTWARETHR A:74 , ASN A:88 , HOH A:282 , ARG B:41binding site for residue CL A 103
4AC4SOFTWAREARG A:8 , LEU A:23 , ASP A:25 , GLY A:27 , GLY A:48 , GLY A:49 , ILE A:50 , PRO A:81 , VAL A:82 , ILE A:84 , ACT A:101 , 6EE A:102 , ARG B:8 , LEU B:23 , ASP B:25 , GLY B:27 , ALA B:28 , ASP B:29 , ASP B:30 , VAL B:32 , GLY B:48 , GLY B:49 , ILE B:50 , VAL B:82 , ILE B:84 , ACT B:102 , HOH B:228 , HOH B:260binding site for residue 6EE B 101
5AC5SOFTWARE6EE A:102 , ALA B:28 , ASP B:29 , ASP B:30 , ILE B:47 , GLY B:48 , 6EE B:101binding site for residue ACT B 102
6AC6SOFTWARETRP B:6binding site for residue CL B 103

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5IVT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5IVT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5IVT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5IVT)

(-) Exons   (0, 0)

(no "Exon" information available for 5IVT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:99
                                                                                                                                  
               SCOP domains --------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee......eeeeee..eeeeeee.......ee........eeeeeeee..eeeeeeeeeeeeeee..eeeeeeeee......eehhhhhhhhh.eee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------- Transcript
                  5ivt A  1 PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99
                                    10        20        30        40        50        60        70        80        90         

Chain B from PDB  Type:PROTEIN  Length:99
                                                                                                                                  
               SCOP domains --------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee......eeeeee..eeeeeee.......ee.........eeeeeee..eeeeeeeeeeeeeee..eeeeeeeee......eehhhhhh....eee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------- Transcript
                  5ivt B  1 PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99
                                    10        20        30        40        50        60        70        80        90         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5IVT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5IVT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5IVT)

(-) Gene Ontology  (4, 8)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6EE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ivt)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ivt
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  C8B467_9HIV1 | C8B467
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  G0X8E8_9HIV1 | G0X8E8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  C8B467_9HIV1 | C8B467
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  G0X8E8_9HIV1 | G0X8E8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        C8B467_9HIV1 | C8B467: 5jfp 5jfu 5jg1 5ult 5uov 5upz
UniProtKB/TrEMBL
        G0X8E8_9HIV1 | G0X8E8: 5cok 5con 5coo 5cop

(-) Related Entries Specified in the PDB File

5ivq 5ivr 5ivs