Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STAPHYLOCOCCUS AUREUS F98Y DIHYDROFOLATE REDUCTASE MUTANT COMPLEXED WITH BETA-NADPH AND 3'-(3-(2,4-DIAMINO-6-ETHYLPYRIMIDIN-5-YL)PROP-2-YN-1-YL)-4'-METHOXY-[1,1'-BIPHENYL]-4-CARBOXYLIC ACID (UCP1106)
 
Authors :  A. C. Anderson, S. M. Reeve
Date :  15 Mar 16  (Deposition) - 28 Jun 17  (Release) - 28 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.84
Chains :  Asym./Biol. Unit :  X
Keywords :  Oxidoreductase, Dihydrofolate Reductase, Nadph, Zwitterion, Antibiotics (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. M. Reeve, E. Scocchera, J. J. Ferreira, N. G-Dayanandan, S. Keshipeddy, D. L. Wright, A. C. Anderson
Charged Propargyl-Linked Antifolates Reveal Mechanisms Of Antifolate Resistance And Inhibit Trimethoprim-Resistant Mrsa Strains Possessing Clinically Relevant Mutations.
J. Med. Chem. V. 59 6493 2016
PubMed-ID: 27308944  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.6B00688

(-) Compounds

Molecule 1 - DIHYDROFOLATE REDUCTASE
    Atcc: 43300
    Chains: X
    EC Number: 1.5.1.3
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET41A+
    Expression System Strain: BL21(DE2)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: FOLA
    Mutation: YES
    Organism Scientific: STAPHYLOCOCCUS AUREUS
    Organism Taxid: 1280
    Synonym: DHFR

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : X

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric/Biological Unit (3, 3)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL
2NAP1Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
3U061Ligand/Ion4-[3-[3-[2,4-BIS(AZANYL)-6-ETHYL-PYRIMIDIN-5-YL]PROP-2-YNYL]-4-METHOXY-PHENYL]BENZOIC ACID

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL X:6 , ALA X:7 , ILE X:14 , GLY X:15 , ASN X:18 , GLN X:19 , LEU X:20 , GLY X:43 , ARG X:44 , LYS X:45 , THR X:46 , LEU X:62 , THR X:63 , SER X:64 , HIS X:77 , ILE X:79 , PHE X:92 , GLY X:94 , GLN X:95 , THR X:96 , TYR X:98 , GLU X:100 , THR X:121 , U06 X:202 , HOH X:322 , HOH X:331 , HOH X:333 , HOH X:336 , HOH X:347 , HOH X:348 , HOH X:357binding site for residue NAP X 201
2AC2SOFTWARELEU X:5 , VAL X:6 , ALA X:7 , ASN X:18 , GLN X:19 , LEU X:20 , ASP X:27 , LEU X:28 , VAL X:31 , SER X:49 , PHE X:92 , TYR X:98 , THR X:111 , NAP X:201 , HOH X:310 , HOH X:316 , HOH X:370binding site for residue U06 X 202
3AC3SOFTWAREARG X:12 , PRO X:125 , TYR X:126 , GLU X:132 , HOH X:339 , HOH X:341binding site for residue GOL X 203

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5ISP)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Gly X:93 -Gly X:94

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5ISP)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5ISP)

(-) Exons   (0, 0)

(no "Exon" information available for 5ISP)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain X from PDB  Type:PROTEIN  Length:157
                                                                                                                                                                                             
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee...eee........hhhhhhhhhhhhh..eeeeehhhhhhhh......eeeee...........eee.hhhhhhhh...eee..hhhhhhhhh....eeeeeee.......ee........eeeeeeee..........eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5isp X   1 TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLYEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK 157
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5ISP)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5ISP)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5ISP)

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    U06  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly X:93 - Gly X:94   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5isp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DYR_STAAU | P0A017
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.5.1.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  DYR_STAAU | P0A017
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DYR_STAAU | P0A017: 2w9g 2w9h 3fra 3frb 3frd 3fre 3frf 3fy8 3fy9 3fyv 3fyw 3i8a 3lg4 3m08 3m09 3sgy 3sh2 3sqy 3sr5 3srq 3srr 3srs 3sru 3srw 4fgg 4fgh 4lae 4lag 4lah 4lek 4xe6 4xec 5hf0 5hf2 5isq 5ist 5jg0

(-) Related Entries Specified in the PDB File

5hf0 5hf2 5isq 5ist