|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3SRW) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3SRW) |
PROSITE Motifs (2, 2)| Asymmetric/Biological Unit (2, 2) |
Exons (0, 0)| (no "Exon" information available for 3SRW) |
Sequences/Alignments
Asymmetric/Biological UnitChain X from PDB Type:PROTEIN Length:157 aligned with DYR_STAAU | P0A017 from UniProtKB/Swiss-Prot Length:159 Alignment length:157 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 DYR_STAAU 2 TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK 158 SCOP domains d3srwx_ X: Dihydrofolate reductase, prokaryotic type SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) DHFR_2 PDB: X:2-157 UniProt: 2-157 - PROSITE (1) PROSITE (2) ------------DHFR_1 PDB: X:14-36 -------------------------------------------------------------------------------------------------------------------------- PROSITE (2) Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3srw X 2 TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK 158 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3SRW) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3SRW) |
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain X (DYR_STAAU | P0A017)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|