Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN MITOCHONDRIAL ISOCITRATE DEHYDROGENASE (IDH2) R140Q MUTANT HOMODIMER IN COMPLEX WITH AG-221 (ENASIDENIB) INHIBITOR.
 
Authors :  W. Wei, B. Zhang, L. Jin, F. Jiang, B. Delabarre, J. A. Travins, A. K. Pady
Date :  19 Feb 16  (Deposition) - 08 Mar 17  (Release) - 05 Jul 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.55
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Idh, Idh2, Enasidenib, Ag-221, Idh2 Ag-221, Icd-M, Idp Nadp(+)- Specific Icdh Oxalosuccinate Decarboxylase, Oxidoreductase- Oxidoreductase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Yen, J. Travins, F. Wang, M. D. David, E. Artin, K. Straley, A. Padyana, S. Gross, B. Delabarre, E. Tobin, Y. Chen, R. Nagaraja, S. Choe, L. Jin, Z. Konteatis, G. Cianchetta, J. O. Saunders, F. G. Salituro, C. Quivoron, P. Opolon, O. Bawa, V. Saada, A. Paci, S. Broutin, O. A. Bernard, S. De Botton, B. S. Marteyn, M. Pilichowska Y. Xu, C. Fang, F. Jiang, W. Wei, S. Jin, L. Silverman, W. Liu, H. Yang, L. Dang, M. Dorsch, V. Penard-Lacronique, S. A. Biller, S. M. Su
Ag-221, A First-In-Class Therapy Targeting Acute Myeloid Leukemia Harboring Oncogenic Idh2 Mutations.
Cancer Discov V. 7 478 2017
PubMed-ID: 28193778  |  Reference-DOI: 10.1158/2159-8290.CD-16-1034
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ISOCITRATE DEHYDROGENASE [NADP], MITOCHONDRIAL
    ChainsA, B
    EC Number1.1.1.42
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Cell LineSF9
    Expression System Taxid7108
    Expression System Vector TypePFASTBAC1
    GeneIDH2
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymIDH,ICD-M,IDP,NADP(+)-SPECIFIC ICDH,OXALOSUCCINATE DECARBOXYLASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 14)

Asymmetric/Biological Unit (6, 14)
No.NameCountTypeFull Name
169Q1Ligand/Ion2-METHYL-1-[(4-[6-(TRIFLUOROMETHYL)PYRIDIN-2-YL]-6-{[2-(TRIFLUOROMETHYL)PYRIDIN-4-YL]AMINO}-1,3,5-TRIAZIN-2-YL)AMINO]PROPAN-2-OL
2ACT2Ligand/IonACETATE ION
3CA2Ligand/IonCALCIUM ION
4GOL5Ligand/IonGLYCEROL
5NA2Ligand/IonSODIUM ION
6NDP2Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:314 , SER A:317 , HOH A:603 , HOH A:605 , HOH A:830 , HOH A:932 , ASP B:291binding site for residue CA A 501
02AC2SOFTWARELYS A:280 , LYS A:282 , GLU A:404 , ASN A:444 , HOH A:612 , HOH A:644 , HOH A:785 , HOH A:814binding site for residue GOL A 502
03AC3SOFTWAREASP A:271 , LYS A:272 , HIS A:273 , TYR A:274 , LYS A:275 , THR A:276 , HOH A:786 , HOH A:867 , HOH A:912 , HOH A:1022binding site for residue GOL A 503
04AC4SOFTWAREPHE A:184 , VAL A:185 , ALA A:186 , ASP A:187 , ARG A:188 , HOH A:760 , TRP B:207 , HOH B:616binding site for residue GOL A 504
05AC5SOFTWAREGLY A:409 , ALA A:410 , MET A:411 , ASN A:428 , GLU A:429 , HIS A:430 , PHE A:431binding site for residue GOL A 505
06AC6SOFTWARELYS A:112 , ALA A:114 , THR A:115 , THR A:117 , ARG A:122 , ASN A:136 , GLU A:345 , HIS A:348 , GLY A:349 , THR A:350 , VAL A:351 , THR A:352 , ARG A:353 , HIS A:354 , ASN A:367 , HOH A:678 , HOH A:704 , HOH A:717 , HOH A:725 , HOH A:726 , HOH A:762 , HOH A:780 , HOH A:796 , HOH A:800 , HOH A:805 , HOH A:813 , HOH A:909 , HOH A:921 , HOH A:1008binding site for residue NDP A 506
07AC7SOFTWAREASN A:136 , GLU A:343 , GLU A:345 , HOH A:665 , HOH A:719 , HOH A:1000binding site for residue NA A 507
08AC8SOFTWAREHIS A:453 , HIS A:454 , HOH A:608 , HOH A:869binding site for residue ACT A 508
09AC9SOFTWAREASP A:291 , ASP B:314 , ASP B:318 , HOH B:705 , HOH B:720 , HOH B:782binding site for residue CA A 509
10AD1SOFTWAREPHE A:196 , HOH A:845 , VAL B:185 , ALA B:186 , ASP B:187 , ARG B:188 , HOH B:617 , HOH B:774binding site for residue GOL B 501
11AD2SOFTWAREILE A:290 , VAL A:294 , TYR A:311 , ASP A:312 , VAL A:315 , GLN A:316 , ILE A:319 , LEU A:320 , LEU B:160 , TRP B:164 , ILE B:290 , VAL B:294 , VAL B:297 , LEU B:298 , TYR B:311 , ASP B:312 , VAL B:315 , GLN B:316 , ILE B:319 , LEU B:320 , HOH B:643binding site for residue 69Q B 502
12AD3SOFTWARELYS B:112 , ALA B:114 , THR B:115 , THR B:117 , ARG B:122 , ASN B:136 , GLU B:345 , HIS B:348 , GLY B:349 , THR B:350 , VAL B:351 , THR B:352 , ARG B:353 , HIS B:354 , THR B:366 , ASN B:367 , ACT B:505 , HOH B:623 , HOH B:639 , HOH B:642 , HOH B:727 , HOH B:748 , HOH B:757 , HOH B:825binding site for residue NDP B 503
13AD4SOFTWAREASN B:136 , GLU B:343 , GLU B:345 , HOH B:743 , HOH B:791 , HOH B:826binding site for residue NA B 504
14AD5SOFTWARETHR B:117 , SER B:134 , NDP B:503 , HOH B:602binding site for residue ACT B 505

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5I96)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5I96)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5I96)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5I96)

(-) Exons   (0, 0)

(no "Exon" information available for 5I96)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:417
                                                                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee....eeeee.hhhhhhhhhhhhhhh....ee..eeeee.hhhhhhhh.hhhhhhhhhhhhhhheeee......hhhhhhhhh......hhhhhhhhhhh.eeeeee................eeeee...hhhhhheeeee...eeeeeeeee......eeeeeeee...eeeeeeeeehhhhhhhhhhhhhhhhhhh..eeeee......hhhhhhhhhhhhhhhhhhhhhhhhh...eeeeehhhhhhhhhh....eeeeehhhhhhhhhhhhhhhh.hhh.eeeeee......eeeee....hhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i96 A  41 DKRIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIQNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQHHHHH 457
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       

Chain B from PDB  Type:PROTEIN  Length:407
                                                                                                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee....eeeee.hhhhhhhhhhhhhhh....ee..eeeee.hhhhhhhh.hhhhhhhhhhhhhhheeee......hhhhhhhhh......hhhhhhhhhhh.eeeeee................eeeee...hhhhhheeeee...eeeeeeeee......eeeeeeee...eeeeeeeeehhhhhhhhhhhhhhhhhhh..eeeee......hhhhhhhhhhhhhhhhhhhhhhhhh...eeeeehhhhhhhhhh....eeeeehhhhhhhhhhhhhhhh.hhh.eeeeee......eeeee....hhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i96 B  43 RIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIQNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRAL 449
                                    52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5I96)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5I96)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5I96)

(-) Gene Ontology  (19, 19)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    69Q  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5i96)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5i96
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IDHP_HUMAN | P48735
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.42
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IDHP_HUMAN | P48735
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IDHP_HUMAN | P487354ja8 5gis 5i95 5svn 5svo

(-) Related Entries Specified in the PDB File

5i95