Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN MITOCHONDRIAL ISOCITRATE DEHYDROGENASE R140Q MUTANT HOMODIMER BOUND TO NADPH AND ALPHA-KETOGLUTARIC ACID
 
Authors :  B. Zhang, L. Jin, W. Wu, F. Jiang, B. Delabarre, J. A. Travins, A. K. Padya
Date :  19 Feb 16  (Deposition) - 01 Mar 17  (Release) - 05 Jul 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.54
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Idh, Icd-M, Idp Nadp(+)-Specific Icdh Oxalosuccinate Decarboxylase, Akg, Alphakg, Oxo-Glutarate. , Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Yen, J. Travins, F. Wang, M. D. David, E. Artin, K. Straley, A. Padyana, S. Gross, B. Delabarre, E. Tobin, Y. Chen, R. Nagaraja, S. Choe, L. Jin, Z. Konteatis, G. Cianchetta, J. O. Saunders, F. G. Salituro, C. Quivoron, P. Opolon, O. Bawa, V. Saada, A. Paci, S. Broutin, O. A. Bernard, S. De Botton, B. S. Marteyn, M. Pilichowska Y. Xu, C. Fang, F. Jiang, W. Wei, S. Jin, L. Silverman, W. Liu, H. Yang, L. Dang, M. Dorsch, V. Penard-Lacronique, S. A. Biller, S. M. Su
Ag-221, A First-In-Class Therapy Targeting Acute Myeloid Leukemia Harboring Oncogenic Idh2 Mutations.
Cancer Discov V. 7 478 2017
PubMed-ID: 28193778  |  Reference-DOI: 10.1158/2159-8290.CD-16-1034
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ISOCITRATE DEHYDROGENASE [NADP], MITOCHONDRIAL
    ChainsA
    EC Number1.1.1.42
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-41A(+)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    FragmentUNP RESIDUES 40-452
    GeneIDH2
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymIDH,ICD-M,IDP,NADP(+)-SPECIFIC ICDH,OXALOSUCCINATE DECARBOXYLASE

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 8)

Asymmetric Unit (5, 8)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2AKG1Ligand/Ion2-OXOGLUTARIC ACID
3CA1Ligand/IonCALCIUM ION
4GOL4Ligand/IonGLYCEROL
5NDP1Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE
Biological Unit 1 (4, 14)
No.NameCountTypeFull Name
1ACT2Ligand/IonACETATE ION
2AKG2Ligand/Ion2-OXOGLUTARIC ACID
3CA-1Ligand/IonCALCIUM ION
4GOL8Ligand/IonGLYCEROL
5NDP2Ligand/IonNADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDEPHOSPHATE

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:112 , ALA A:114 , THR A:115 , ILE A:116 , THR A:117 , ARG A:122 , ASN A:136 , LEU A:289 , ASP A:292 , GLN A:296 , LYS A:299 , HIS A:348 , GLY A:349 , THR A:350 , VAL A:351 , THR A:352 , ARG A:353 , HIS A:354 , ASN A:367 , AKG A:508 , HOH A:665 , HOH A:683 , HOH A:711 , HOH A:724 , HOH A:733 , HOH A:746 , HOH A:761 , HOH A:776 , HOH A:780 , HOH A:785 , HOH A:786 , HOH A:811 , HOH A:880 , HOH A:948binding site for residue NDP A 501
2AC2SOFTWAREARG A:149 , ASP A:291 , ASP A:314 , ASP A:318 , AKG A:508 , HOH A:619 , HOH A:658binding site for residue CA A 502
3AC3SOFTWAREPHE A:184 , VAL A:185 , ALA A:186 , ASP A:187 , ARG A:188 , PHE A:196 , HOH A:640 , HOH A:668binding site for residue GOL A 503
4AC4SOFTWAREPHE A:148 , GLU A:150 , TYR A:238 , ARG A:377 , HOH A:629 , HOH A:791binding site for residue GOL A 504
5AC5SOFTWARELYS A:280 , LYS A:282 , GOL A:506 , HOH A:769binding site for residue GOL A 505
6AC6SOFTWAREMET A:397 , GLU A:404 , ARG A:451 , GOL A:505 , HOH A:617 , HOH A:920binding site for residue GOL A 506
7AC7SOFTWARELYS A:413 , PHE A:431binding site for residue ACT A 507
8AC8SOFTWARETHR A:117 , SER A:134 , ASN A:136 , ARG A:149 , ARG A:172 , LYS A:251 , ILE A:254 , ASP A:291 , ASP A:314 , ALA A:347 , NDP A:501 , CA A:502 , HOH A:632 , HOH A:658 , HOH A:733 , HOH A:822binding site for residue AKG A 508

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5I95)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5I95)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5I95)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5I95)

(-) Exons   (0, 0)

(no "Exon" information available for 5I95)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:413
                                                                                                                                                                                                                                                                                                                                                                                                                                                             
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee....eeeee.hhhhhhhhhhhhhhh....ee..eeeee.hhhhhhhh.hhhhhhhhhhhhhhheeee......hhhhhhhhh......hhhhhhhhhhh.eeeeee.................eeeee..hhhhhheeeee...eeeeeee........eeeeeeee...eeeee...hhhhhhhhhhhhhhhhhhhh..eeeee......hhhhhhhhhhhhhhhhhhhhhhhhh...eeeeehhhhhhhhhhh....eeeehhhhhhhhhhhhhhhhh....eeeeee......eeee.....hhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5i95 A  41 DKRIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIQNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQL 453
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5I95)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5I95)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5I95)

(-) Gene Ontology  (19, 19)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    AKG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5i95)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5i95
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IDHP_HUMAN | P48735
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.42
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IDHP_HUMAN | P48735
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IDHP_HUMAN | P487354ja8 5gis 5i96 5svn 5svo

(-) Related Entries Specified in the PDB File

5i96