Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HASPIN (GSG2) IN COMPLEX WITH BISUBSTRATE INHIBITOR ARC-3372
 
Authors :  A. Chaikuad, C. Heroven, D. Lavogina, K. Kestav, A. Uri, F. Von Delft, C. H. Arrowsmith, A. M. Edwards, C. Bountra, S. Knapp, Structural Gen Consortium (Sgc)
Date :  26 Jan 16  (Deposition) - 16 Mar 16  (Release) - 11 May 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A,C
Keywords :  Transferase, Kinase, Inhibitor, Allosteric, Structural Genomics Consortium (Sgc), Transferase-Transferase Inhibitor Complex, Bisubstrate Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Lavogina, K. Kestav, A. Chaikuad, C. Heroven, S. Knapp, A. Uri
Co-Crystal Structures Of The Protein Kinase Haspin With Bisubstrate Inhibitors.
Acta Crystallogr. , Sect. F V. 72 339 2016
PubMed-ID: 27139824  |  Reference-DOI: 10.1107/S2053230X16004611

(-) Compounds

Molecule 1 - SERINE/THREONINE-PROTEIN KINASE HASPIN
    Chains: A
    EC Number: 2.7.11.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PNIC28-BSA4
    Expression System Taxid: 562
    Expression System Variant: R3-PRARE2
    Expression System Vector Type: PLASMID
    Gene: GSG2
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Other Details: KINASE DOMAIN (465-798)
    Synonym: GERM CELL-SPECIFIC GENE 2 PROTEIN,H-HASPIN,HAPLOID GERM CELL-SPECIFIC NUCLEAR PROTEIN KINASE
 
Molecule 2 - ARC-3372 INHIBITOR
    Chains: C
    Engineered: YES
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630
    Synthetic: YES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 6)

Asymmetric/Biological Unit (5, 6)
No.NameCountTypeFull Name
166M1Ligand/Ion(2R)-2-{[6-({[(2S,3S,4R,5R)-5-(6-AMINO-9H-PURIN-9-YL)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]CARBONYL}AMINO)HEXANOYL]AMINO}BUTANEDIOIC ACID (NON-PREFERRED NAME)
266N1Mod. Amino AcidL-ALANINAMIDE
3DMS1Ligand/IonDIMETHYL SULFOXIDE
4MPD2Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
5NA1Ligand/IonSODIUM ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:728 , TYR A:739 , LEU A:782 , ASN A:783 , PHE A:784binding site for residue MPD A 801
2AC2SOFTWAREPRO A:571 , ARG A:695 , ILE A:698 , HOH A:1118binding site for residue MPD A 802
3AC3SOFTWAREGLU A:554 , PHE A:556 , SER A:684 , HOH A:906 , HOH A:938 , HOH A:1159binding site for residue NA A 803
4AC4SOFTWARETYR A:667 , LYS A:672 , SER A:674 , HOH A:910binding site for residue DMS A 804
5AC5SOFTWAREILE A:490 , GLY A:491 , GLU A:492 , GLY A:493 , VAL A:494 , PHE A:495 , GLY A:496 , ALA A:509 , ILE A:557 , GLU A:606 , PHE A:607 , GLY A:608 , GLY A:609 , ASP A:611 , GLY A:653 , LEU A:656 , ILE A:686 , ASP A:687 , THR A:689 , HOH A:933 , HOH A:935 , HOH A:937 , HOH A:940 , HOH A:1053 , ARG C:2 , LYS C:3 , HOH C:202 , HOH C:203 , HOH C:206 , HOH C:211 , HOH C:212 , HOH C:215binding site for residue 66M C 101
6AC6SOFTWAREGLN C:5 , THR C:6binding site for Ligand 66N C 7 bound to THR C 6

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5HTC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5HTC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HTC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HTC)

(-) Exons   (0, 0)

(no "Exon" information available for 5HTC)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:328
                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh.eeeeee..eeeeeeee..eeeeeeeeee....ee..ee..hhhhhhhhhhhhhhhhhhhhh..........eeeeeeee...hhhhhhhhhhhhhhh..............eeeeeeee...ee.........hhhhhhhhhhhhhhhhhhhhhhhh..........eeeee....eeeeee..eeeeee...eeeee.......eee..eee...............hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5htc A 471 GPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK 798
                                   480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790        


Chain C from PDB  Type:PROTEIN  Length:7
                                       
               SCOP domains ------- SCOP domains
               CATH domains ------- CATH domains
               Pfam domains ------- Pfam domains
         Sec.struct. author ....... Sec.struct. author
                 SAPs(SNPs) ------- SAPs(SNPs)
                    PROSITE ------- PROSITE
                 Transcript ------- Transcript
                 5htc C   1 ARKKQTx   7
                                  |
                                  7-66N
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5HTC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5HTC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HTC)

(-) Gene Ontology  (22, 22)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    66M  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    66N  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MPD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5htc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5htc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HASP_HUMAN | Q8TF76
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HASP_HUMAN | Q8TF76
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HASP_HUMAN | Q8TF76: 2vuw 2wb8 3dlz 3e7v 3f2n 3fmd 3iq7 4ouc 4qtc 5htb

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5HTC)