Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF RECOMBINANT HIRUDIN AND THE LYS-47 (RIGHT ARROW) GLU MUTANT. A NUCLEAR MAGNETIC RESONANCE AND HYBRID DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING STUDY
 
Authors :  G. M. Clore, A. M. Gronenborn
Date :  09 Jan 90  (Deposition) - 15 Jan 90  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Coagulation Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. J. Folkers, G. M. Clore, P. C. Driscoll, J. Dodt, S. Kohler, A. M. Gronenborn
Solution Structure Of Recombinant Hirudin And The Lys-47----Glu Mutant: A Nuclear Magnetic Resonance And Hybrid Distance Geometry-Dynamical Simulated Annealing Study.
Biochemistry V. 28 2601 1989
PubMed-ID: 2567183  |  Reference-DOI: 10.1021/BI00432A038
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HIRUDIN VARIANT-1
    Chains: A
    Engineered: YES
    Organism Common: MEDICINAL LEECH
    Organism Scientific: HIRUDO MEDICINALIS
    Organism Taxid: 6421

 Structural Features

(-) Chains, Units

  
NMR Structure : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5HIR)

(-) Sites  (0, 0)

(no "Site" information available for 5HIR)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:6 -A:14
2A:16 -A:28
3A:22 -A:39

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5HIR)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HIR)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HIR)

(-) Exons   (0, 0)

(no "Exon" information available for 5HIR)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:49
                                                                                
               SCOP domains d5hira_ A: Hirudin                                SCOP domains
               CATH domains 5hirA00 A:1-49                                    CATH domains
               Pfam domains ------------------------------------------------- Pfam domains
         Sec.struct. author ........eee..eee....ee....eeeee....eeeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------- Transcript
                  5hir A  1 VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQ 49
                                    10        20        30        40
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HIR)

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5hir)
 
  Sites
(no "Sites" information available for 5hir)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5hir)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)
Midas
  ribbon, secondary structure
[ mono GIF format | stereo GIF format ]
Setor
  ribbon, secondary structure, SS bonds, labeling
[ mono GIF format | stereo GIF format ]
  spacefill
[ mono GIF format | stereo GIF format ]
Distance Plot
  representative atom: CA
[ mono GIF format | mono PDF format ]

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5hir
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HIRV1_HIRME | P01050
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HIRV1_HIRME | P01050
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HIRV1_HIRME | P01050: 1ad8 1ae8 1afe 1aht 1ai8 1awf 1ay6 1ba8 1bb0 1bcu 1ca8 1d3d 1d3p 1d3q 1d3t 1d4p 1h8d 1h8i 1hic 1hrt 1hxe 1hxf 1no9 1qhr 1qj1 1qj6 1qj7 1tmt 1tmu 1uma 1wbg 2hir 2joo 2pw8 2uuf 2uuj 2uuk 2v3o 2zc9 2zda 2zdv 2zf0 2zff 2zfp 2zgb 2zgx 2zhq 2zi2 2ziq 2znk 2zo3 3d49 3dhk 3dt0 3dux 3egk 3eq0 3ldx 3utu 4ax9 4bah 4bak 4bam 4ban 4baq 4hir 4lxb 4mlf 4yes 6hir

(-) Related Entries Specified in the PDB File

2hir