Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  MMIFT52 N-TERMINAL DOMAIN
 
Authors :  A. Mourao, E. Lorentzen
Date :  09 Nov 15  (Deposition) - 09 Mar 16  (Release) - 13 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.49
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Keywords :  Transport Protein, Intraflagellar Transport, Iftb, Ift52, Protein-Protein Interaction (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Taschner, K. Weber, A. Mourao, M. Vetter, M. Awasthi, M. Stiegler, S. Bhogaraju, E. Lorentzen
Intraflagellar Transport Proteins 172, 80, 57, 54, 38, And 20 Form A Stable Tubulin-Binding Ift-B2 Complex.
Embo J. V. 35 773 2016
PubMed-ID: 26912722  |  Reference-DOI: 10.15252/EMBJ.201593164

(-) Compounds

Molecule 1 - INTRAFLAGELLAR TRANSPORT PROTEIN 52 HOMOLOG
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PEC-A-HT-HIS
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: GIFT, RESIDUES 1-268
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090
    Synonym: PROTEIN NGD5, IFT52

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit : ABC
Biological Unit 1 (1x): A  
Biological Unit 2 (1x):  B 
Biological Unit 3 (1x):   C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5FMS)

(-) Sites  (0, 0)

(no "Site" information available for 5FMS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5FMS)

(-) Cis Peptide Bonds  (11, 11)

Asymmetric Unit
No.Residues
1Lys A:178 -Pro A:179
2Phe A:191 -Pro A:192
3Gln A:206 -Gly A:207
4Thr A:243 -Gly A:244
5Lys B:178 -Pro B:179
6Phe B:191 -Pro B:192
7Lys B:204 -Asn B:205
8Gln B:206 -Gly B:207
9Thr B:243 -Gly B:244
10Lys C:178 -Pro C:179
11Phe C:191 -Pro C:192

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5FMS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5FMS)

(-) Exons   (0, 0)

(no "Exon" information available for 5FMS)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:228
                                                                                                                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee............hhhhhhhhh....eeee.............eeeee......hhhhhhhhhhhhhh..eeeee....hhhhhh..hhhhhh...eee.....ee..........eeee.....hhhhh..........eeee....eee....eeeee....ee....eeeeee........eeeee.hhhhhhhhhhh..hhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5fms A   7 STILFNAYKKEVFTTNTGTKSLQKRLRSNWKIQSLKDEITSEKLIGVKLWITAGPREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYYKYFHPKEALVSDGVLNREISRAAGKAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSKNQGFGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTGDIHL 248
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146||     170       180       190       200       210       220       230       240        
                                                                                                                                                                      147|                                                                                      
                                                                                                                                                                       162                                                                                      


Chain B from PDB  Type:PROTEIN  Length:225
                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee............hhhhhhhhh....eeee.............eeeee......hhhhhhhhhhhhhh..eeeee...hhhhh....hhhhhh...eee.................eeee.....hhhhh........eeee....eee....eeeee..........eeeeee........eeeee.hhhhhhhhhhh..hhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5fms B   8 TILFNAYKKEVFTTNTGTKSLQKRLRSNWKIQSLKDEITSEKLIGVKLWITAGPREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYYKYFHPKEALVSDGVLNREISRAAAQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSKNQGFGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQWLTTGDIHL 248
                                    17        27        37        47        57        67        77        87        97       107       117       127       137      |163       173       183       193       203       213       223       233       243     
                                                                                                                                                                  144|                                                                                       
                                                                                                                                                                   161                                                                                       


Chain C from PDB  Type:PROTEIN  Length:208
                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.............hhhhhh........................eeeee......hhhhhhhhhhhhhh..eeeee...hhhhh...hhhhhhh...eee.....ee..........eeee.....hhhhh......eeee....eee....eeeee....ee....eeeeee..eeee.hhhhhh.......hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5fms C   9 ILFNAYKKEVFTTNTGTKSLQKRLRSNWKIQSLKDEITSEKLIGVKLWITAGPREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVYYKYFHPKEALVSDGVLNREISRAAALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHKLAVLGSCHMFSDQYLDKEENSKIMDVVFQWL 241
                                    18        28        38        48        58        68        78        88        98       108       118       128       138     ||166       176       186       196     ||213       223       233        
                                                                                                                                                                 144|                                    202|                               
                                                                                                                                                                  163                                     210
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5FMS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5FMS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5FMS)

(-) Gene Ontology  (21, 21)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5fms)
 
  Sites
(no "Sites" information available for 5fms)
 
  Cis Peptide Bonds
    Gln A:206 - Gly A:207   [ RasMol ]  
    Gln B:206 - Gly B:207   [ RasMol ]  
    Lys A:178 - Pro A:179   [ RasMol ]  
    Lys B:178 - Pro B:179   [ RasMol ]  
    Lys B:204 - Asn B:205   [ RasMol ]  
    Lys C:178 - Pro C:179   [ RasMol ]  
    Phe A:191 - Pro A:192   [ RasMol ]  
    Phe B:191 - Pro B:192   [ RasMol ]  
    Phe C:191 - Pro C:192   [ RasMol ]  
    Thr A:243 - Gly A:244   [ RasMol ]  
    Thr B:243 - Gly B:244   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5fms
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IFT52_MOUSE | Q62559
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IFT52_MOUSE | Q62559
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5FMS)

(-) Related Entries Specified in the PDB File

5fmr CRIFT52 N-TERMINAL DOMAIN