Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE
 
Authors :  L. Raich, V. Borodkin, D. M. F. Van Aalten, R. Hurtado-Guerrero, C. Ro
Date :  25 Sep 15  (Deposition) - 17 Feb 16  (Release) - 30 Mar 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A
Keywords :  Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Raich, V. Borodkin, W. Fang, J. Castro-Lopez, D. M. F. Van Aalten, R. Hurtado-Guerrero, C. Rovira
The Pathway To Transglycosylation. Insights From Experiments And Quantum Mechanics/Molecular Mechanics Simulations.
J. Am. Chem. Soc. V. 138 3325 2016
PubMed-ID: 26859322  |  Reference-DOI: 10.1021/JACS.5B10092

(-) Compounds

Molecule 1 - 1,3-BETA-GLUCANOSYLTRANSFERASE
    Chains: A
    EC Number: 2.4.1.-
    Engineered: YES
    Expression System: PICHIA PASTORIS
    Expression System Plasmid: PPICZALPHAA
    Expression System Strain: X33
    Expression System Taxid: 4922
    Expression System Vector Type: PLASMID
    Mutation: YES
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 9)

Asymmetric/Biological Unit (2, 9)
No.NameCountTypeFull Name
1BGC7Ligand/IonBETA-D-GLUCOSE
2GLC2Ligand/IonALPHA-D-GLUCOSE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:62 , TYR A:107 , ASP A:132 , SER A:134 , PRO A:136 , SER A:139 , ILE A:140 , ARG A:142 , ASN A:175 , GLN A:176 , VAL A:177 , ASN A:242 , TYR A:244 , GLU A:275 , TYR A:307 , MET A:308 , ASN A:314 , BGC A:609 , HOH A:2095 , HOH A:2259 , HOH A:2260BINDING SITE FOR POLY-SACCHARIDE RESIDUES GLC A 601 THROUGH BGC A 604
2AC2SOFTWAREGLN A:62 , TYR A:107 , ASP A:132 , SER A:134 , PRO A:136 , SER A:139 , ILE A:140 , ARG A:142 , ASN A:175 , GLN A:176 , VAL A:177 , ASN A:216 , ASP A:217 , ASP A:218 , ARG A:222 , ASN A:242 , GLU A:245 , CYS A:247 , THR A:254 , ARG A:260 , LEU A:280 , TYR A:307 , MET A:308 , GLC A:601 , HOH A:2095 , HOH A:2123 , HOH A:2151 , HOH A:2152 , HOH A:2154 , HOH A:2174 , HOH A:2175 , HOH A:2259 , HOH A:2260 , HOH A:2261BINDING SITE FOR POLY-SACCHARIDE RESIDUES BGC A 605 THROUGH BGC A 609

(-) SS Bonds  (7, 7)

Asymmetric/Biological Unit
No.Residues
1A:89 -A:118
2A:231 -A:367
3A:247 -A:278
4A:390 -A:442
5A:392 -A:489
6A:399 -A:466
7A:419 -A:424

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Arg A:282 -Pro A:283
2Tyr A:307 -Met A:308

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5FIH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5FIH)

(-) Exons   (0, 0)

(no "Exon" information available for 5FIH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:438
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeee..eeee........eeeee.........hhhhhhhhhhhhhhhhhhhh..eeee........hhhhhhhhhhh..eeeee...............hhhhhhhhhhhhhhhh....eeeeeeee.......hhhhhhhhhhhhhhhhhhhhhh......eeeee.....hhhhhhhhh.........eeeee.......hhhhhhhhhhhhhhh.....eeeeee..........hhhhhhhhhhhhh...eeee............eee.....eee.hhhhhhhhhhhhh...............................hhhhhhhhhhhh.eee...hhhhhhhhhhh...hhhhh.ee....ee......hhhhhhhhhhhhhhhhhh............eee.hhhhh.hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5fih A  29 SFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNQVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEESVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPCKNVFDSIRDIT 500
                                    38        48        58   ||   81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351||     372       382       392       402 ||    416       426       436       446       456       466       476     ||492        
                                                            62|                                                                                                                                                                                                                                                                                 352|                                     404|                                                                      482|           
                                                             76                                                                                                                                                                                                                                                                                  364                                      409                                                                       489
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5FIH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5FIH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5FIH)

(-) Gene Ontology  (11, 16)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BGC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg A:282 - Pro A:283   [ RasMol ]  
    Tyr A:307 - Met A:308   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5fih
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GAS2_YEAST | Q06135
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  N1P1N2_YEASC | N1P1N2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GAS2_YEAST | Q06135
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  N1P1N2_YEASC | N1P1N2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GAS2_YEAST | Q06135: 2w61 2w62 2w63

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5FIH)