Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  SACCHAROMYCES CEREVISIAE GAS2P APOSTRUCTURE (E176Q MUTANT)
 
Authors :  A. W. Schuettelkopf, R. Hurtado-Guerrero, D. M. F. Van Aalten
Date :  16 Dec 08  (Deposition) - 10 Feb 09  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.62
Chains :  Asym./Biol. Unit :  A
Keywords :  Glycoprotein, Cell Membrane, Fungal Cell Wall, Transglycosylation, Glucan, Membrane, Gpi-Anchor, Lipoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Hurtado-Guerrero, A. W. Schuttelkopf, I. Mouyna, A. F. M. Ibrahim, S. Shepherd, T. Fontaine, J. Latge, D. M. F. Van Aalten
Molecular Mechanisms Of Yeast Cell Wall Glucan Remodeling.
J. Biol. Chem. V. 284 8461 2009
PubMed-ID: 19097997  |  Reference-DOI: 10.1074/JBC.M807990200

(-) Compounds

Molecule 1 - GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
    ChainsA
    EC Number2.4.1.-
    EngineeredYES
    Expression SystemPICHIA PASTORIS
    Expression System PlasmidPPICZALPHA-BASED
    Expression System StrainX33
    Expression System Taxid4922
    MutationYES
    Organism CommonBAKER'S YEAST
    Organism ScientificSACCHAROMYCES CEREVISIAE
    Organism Taxid4932
    StrainW303
    SynonymGAS2P

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2W61)

(-) Sites  (0, 0)

(no "Site" information available for 2W61)

(-) SS Bonds  (7, 7)

Asymmetric/Biological Unit
No.Residues
1A:89 -A:118
2A:231 -A:367
3A:247 -A:278
4A:390 -A:442
5A:392 -A:489
6A:399 -A:466
7A:419 -A:424

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Arg A:63 -Ser A:64
2Arg A:282 -Pro A:283
3Tyr A:307 -Met A:308
4Ser A:485 -Glu A:486

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2W61)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2W61)

(-) Exons   (0, 0)

(no "Exon" information available for 2W61)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:470
 aligned with GAS2_YEAST | Q06135 from UniProtKB/Swiss-Prot  Length:555

    Alignment length:480
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506
           GAS2_YEAST    27 GVSFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSEEELSNANGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKEPTEVESVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGAESGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPLTSESICKNVFDSIRNITYNHGDY 506
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains Glyco_hydro_72-2w61A01 A:27-344                                                                                                                                                                                                                                                                                               ---------------    ---------------------------------X8-2w61A02 A:397-473                                                         --------------------------------- Pfam domains
         Sec.struct. author .........eeee..eeee........eeeee......------..........hhhhhhhhhhhhhhhhhhhh..eeee........hhhhhhhhhhh..eeeee...............hhhhhhhhhhhhhhhh....eeeeeeee.......hhhhhhhhhhhhhhhhhhhhhh......eeeee.....hhhhhhhhh.........eeeee.......hhhhhhhhhhhhhhh.....eeeeee..........hhhhhhhhhhhhh...eeee............eee.....eeehhhhhhhhhhhhhh.....hhhhhhh....----......................hhhhhhhhhhhh.eee.....hhhhhhhhhhhhh...hhhhh.ee....ee......hhhhhhhhhhhhhhhhhh............eee.hhhhh.......hhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2w61 A  27 GVSFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRS------ANGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNQVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKEP----SVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGAESGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPLTSESICKNVFDSIRNITYNHGDY 506
                                    36        46        56       | -    |   76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356  |    366       376       386       396       406       416       426       436       446       456       466       476       486       496       506
                                                                64     71                                                                                                                                                                                                                                                                                             359  364                                                                                                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2W61)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2W61)

(-) Pfam Domains  (2, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (11, 11)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (GAS2_YEAST | Q06135)
molecular function
    GO:0042124    1,3-beta-glucanosyltransferase activity    Catalysis of the splitting and linkage of (1->3)-beta-D-glucan molecules, resulting in (1->3)-beta-D-glucan chain elongation.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0030476    ascospore wall assembly    The aggregation, arrangement and bonding together of a set of components to form an ascospore wall. During sporulation in Ascomycota, each ascospore nucleus becomes surrounded by a specialized spore wall, formed by deposition of spore wall components in the lumenal space between the outer and inner leaflets of the prospore membrane. An example of this process is found in Saccharomyces cerevisiae.
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0071555    cell wall organization    A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.
    GO:0071970    fungal-type cell wall (1->3)-beta-D-glucan biosynthetic process    The chemical reactions and pathways resulting in the formation of (1->3)-beta-D-glucans, compounds composed of glucose residues linked by (1->3)-beta-D-glucosidic bonds, found in fungal cell walls.
cellular component
    GO:0031362    anchored component of external side of plasma membrane    The component of the plasma membrane consisting of the gene products that are tethered to the external side of the membrane only by a covalently attached anchor, such as a lipid group embedded in the membrane. Gene products with peptide sequences that are embedded in the membrane are excluded from this grouping.
    GO:0031225    anchored component of membrane    The component of a membrane consisting of the gene products that are tethered to the membrane only by a covalently attached anchor, such as a lipid group that is embedded in the membrane. Gene products with peptide sequences that are embedded in the membrane are excluded from this grouping.
    GO:0009277    fungal-type cell wall    A rigid yet dynamic structure surrounding the plasma membrane that affords protection from stresses and contributes to cell morphogenesis, consisting of extensively cross-linked glycoproteins and carbohydrates. The glycoproteins may be modified with N- or O-linked carbohydrates, or glycosylphosphatidylinositol (GPI) anchors; the polysaccharides are primarily branched glucans, including beta-linked and alpha-linked glucans, and may also include chitin and other carbohydrate polymers, but not cellulose or pectin. Enzymes involved in cell wall biosynthesis are also found in the cell wall. Note that some forms of fungi develop a capsule outside of the cell wall under certain circumstances; this is considered a separate structure.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2w61)
 
  Sites
(no "Sites" information available for 2w61)
 
  Cis Peptide Bonds
    Arg A:282 - Pro A:283   [ RasMol ]  
    Arg A:63 - Ser A:64   [ RasMol ]  
    Ser A:485 - Glu A:486   [ RasMol ]  
    Tyr A:307 - Met A:308   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2w61
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GAS2_YEAST | Q06135
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.1.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GAS2_YEAST | Q06135
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GAS2_YEAST | Q061352w62 2w63 5fih

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2W61)