Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CHOLERA TOXIN CLASSICAL B-PENTAMER IN COMPLEX WITH LEWIS-Y
 
Authors :  J. E. Heggelund, D. Burschowsky, U. Krengel
Date :  04 Nov 15  (Deposition) - 30 Mar 16  (Release) - 27 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.08
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J
Biol. Unit 1:  A,B,C,D,E,I  (1x)
Biol. Unit 2:  E,F,G,H,I,J  (1x)
Keywords :  Cholera Toxin B-Pentamer, Lewis-Y, Complex, Blood Group Oligosaccharide/Antigen, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. E. Heggelund, D. Burschowsky, V. A. Bjrnestad, V. Hodnik, G. Anderluh, U. Krengel
High-Resolution Crystal Structures Elucidate The Molecular Basis Of Cholera Blood Group Dependence.
Plos Pathog. V. 12 05567 2016
PubMed-ID: 27082955  |  Reference-DOI: 10.1371/JOURNAL.PPAT.1005567

(-) Compounds

Molecule 1 - CHOLERA ENTEROTOXIN B SUBUNIT
    Chains: A, B, C, D, E, F, G, H, I, J
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Taxid: 469008
    Gene: CTXB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
    Organism Scientific: VIBRIO CHOLERAE
    Organism Taxid: 666
    Synonym: CHOLERA ENTEROTOXIN SUBUNIT B,CHOLERA TOXIN B PROTEIN (CTB), CHOLERA TOXIN B SUBUNIT,CHOLERA TOXIN BETA SUBUNIT,CHOLERA TOXIN SUBUNIT B,CHOLERAE TOXIN B SUBUNIT,CTXB

 Structural Features

(-) Chains, Units

  12345678910
Asymmetric Unit : ABCDEFGHIJ
Biological Unit 1 (1x): ABCDE   I 
Biological Unit 2 (1x):     EFGHIJ

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (8, 83)

Asymmetric Unit (8, 83)
No.NameCountTypeFull Name
1BCN10Ligand/IonBICINE
2CA10Ligand/IonCALCIUM ION
3FUC20Ligand/IonALPHA-L-FUCOSE
4GAL20Ligand/IonBETA-D-GALACTOSE
5GLA10Ligand/IonALPHA D-GALACTOSE
6NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
7NDG10Ligand/Ion2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE
8PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
Biological Unit 1 (6, 47)
No.NameCountTypeFull Name
1BCN10Ligand/IonBICINE
2CA-1Ligand/IonCALCIUM ION
3FUC12Ligand/IonALPHA-L-FUCOSE
4GAL12Ligand/IonBETA-D-GALACTOSE
5GLA6Ligand/IonALPHA D-GALACTOSE
6NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
7NDG6Ligand/Ion2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE
8PEG-1Ligand/IonDI(HYDROXYETHYL)ETHER
Biological Unit 2 (7, 41)
No.NameCountTypeFull Name
1BCN2Ligand/IonBICINE
2CA-1Ligand/IonCALCIUM ION
3FUC12Ligand/IonALPHA-L-FUCOSE
4GAL12Ligand/IonBETA-D-GALACTOSE
5GLA6Ligand/IonALPHA D-GALACTOSE
6NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
7NDG6Ligand/Ion2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE
8PEG1Ligand/IonDI(HYDROXYETHYL)ETHER

(-) Sites  (53, 53)

Asymmetric Unit (53, 53)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLU A:79 , BCN A:204 , HOH A:406 , GLU H:79binding site for residue CA A 201
02AC2SOFTWAREGLU A:51 , GLN A:56 , HIS A:57 , GLN A:61 , TRP A:88 , ASN A:90 , LYS A:91 , GLA A:203 , HOH A:319 , HOH A:324 , HOH A:343 , HOH A:349binding site for residue GAL A 202
03AC3SOFTWAREGLU A:51 , GLN A:56 , HIS A:57 , GLN A:61 , TRP A:88 , ASN A:90 , LYS A:91 , GAL A:202 , HOH A:319 , HOH A:324 , HOH A:343 , HOH A:349binding site for residue GLA A 203
04AC4SOFTWAREGLU A:79 , CA A:201 , HOH A:309 , HOH A:322 , HOH A:334 , HOH A:406 , ALA G:80 , LYS G:81 , ASN G:103 , TYR H:76 , LEU H:77 , GLU H:79 , HOH H:1309binding site for residue BCN A 204
05AC5SOFTWAREGLU A:79 , BCN A:206 , HOH A:411 , GLU H:79binding site for residue CA A 205
06AC6SOFTWARETYR A:76 , LEU A:77 , GLU A:79 , CA A:205 , HOH A:314 , HOH A:322 , HOH A:374 , HOH A:411 , ALA E:80 , LYS E:81 , ASN E:103 , LYS H:23 , GLU H:79binding site for residue BCN A 206
07AC7SOFTWAREGLU B:79 , BCN B:202 , HOH F:1363 , GLU G:79binding site for residue CA B 201
08AC8SOFTWARELYS B:23 , GLU B:79 , CA B:201 , HOH B:307 , HOH B:388 , ALA F:80 , LYS F:81 , ASN F:103 , HOH F:1363 , TYR G:76 , LEU G:77 , GLU G:79 , HOH G:327binding site for residue BCN B 202
09AC9SOFTWAREGLU B:51 , GLN B:56 , HIS B:57 , GLN B:61 , TRP B:88 , ASN B:90 , LYS B:91 , GLA B:204 , HOH B:312 , HOH B:316 , HOH B:324 , HOH B:381binding site for residue GAL B 203
10AD1SOFTWAREGLU B:51 , GLN B:56 , HIS B:57 , GLN B:61 , TRP B:88 , ASN B:90 , LYS B:91 , GAL B:203 , HOH B:312 , HOH B:316 , HOH B:324 , HOH B:381 , HOH B:403binding site for residue GLA B 204
11AD2SOFTWAREGLU B:79 , BCN B:206 , HOH B:410 , GLU G:79binding site for residue CA B 205
12AD3SOFTWAREALA A:80 , LYS A:81 , ASN A:103 , TYR B:76 , LEU B:77 , GLU B:79 , CA B:205 , HOH B:307 , HOH B:315 , HOH B:320 , HOH B:410 , LYS G:23 , GLU G:79binding site for residue BCN B 206
13AD4SOFTWAREGLU C:79 , BCN C:206 , GLU F:79 , HOH J:1325binding site for residue CA C 201
14AD5SOFTWAREGLU C:51 , GLN C:56 , HIS C:57 , GLN C:61 , TRP C:88 , ASN C:90 , LYS C:91 , GLA C:203 , HOH C:307 , HOH C:327 , HOH C:337 , HOH C:356 , HOH D:376binding site for residue GAL C 202
15AD6SOFTWAREGLU C:51 , GLN C:56 , HIS C:57 , GLN C:61 , TRP C:88 , ASN C:90 , LYS C:91 , GAL C:202 , HOH C:307 , HOH C:327 , HOH C:337 , HOH C:356 , HOH D:376binding site for residue GLA C 203
16AD7SOFTWAREGLU C:79 , BCN C:205 , HOH C:418 , GLU F:79binding site for residue CA C 204
17AD8SOFTWAREALA B:80 , LYS B:81 , ASN B:103 , TYR C:76 , LEU C:77 , GLU C:79 , CA C:204 , HOH C:306 , HOH C:315 , HOH C:318 , HOH C:418 , LYS F:23 , GLU F:79binding site for residue BCN C 205
18AD9SOFTWAREGLU C:79 , CA C:201 , HOH C:318 , HOH C:413 , TYR F:76 , LEU F:77 , GLU F:79 , HOH F:1315 , ALA J:80 , LYS J:81 , ASN J:103 , HOH J:1325binding site for residue BCN C 206
19AE1SOFTWARELYS C:81 , ASN C:103 , HOH C:355 , TYR D:76 , LEU D:77 , GLU D:79 , CA D:206 , HOH D:307 , HOH D:312 , HOH D:318 , GLU J:79binding site for residue BCN D 201
20AE2SOFTWAREGLU D:79 , BCN D:203 , HOH D:397 , GLU J:79binding site for residue CA D 202
21AE3SOFTWARELYS D:23 , GLU D:79 , CA D:202 , HOH D:307 , HOH D:331 , HOH D:397 , ALA I:80 , LYS I:81 , ASN I:103 , TYR J:76 , LEU J:77 , GLU J:79 , HOH J:1321binding site for residue BCN D 203
22AE4SOFTWAREGLU D:51 , GLN D:56 , HIS D:57 , GLN D:61 , TRP D:88 , ASN D:90 , LYS D:91 , GLA D:205 , HOH D:323 , HOH D:340 , HOH D:354 , HOH D:373 , HOH D:392binding site for residue GAL D 204
23AE5SOFTWAREGLU D:51 , GLN D:56 , HIS D:57 , GLN D:61 , TRP D:88 , ASN D:90 , LYS D:91 , GAL D:204 , HOH D:323 , HOH D:340 , HOH D:354 , HOH D:373binding site for residue GLA D 205
24AE6SOFTWAREHOH C:355 , GLU D:79 , BCN D:201 , GLU J:79binding site for residue CA D 206
25AE7SOFTWAREALA D:80 , LYS D:81 , ASN D:103 , HOH D:301 , HOH D:357 , TYR E:76 , LEU E:77 , GLU E:79 , CA E:206 , HOH E:309 , HOH E:315 , LYS I:23 , GLU I:79 , HOH I:1389binding site for residue BCN E 201
26AE8SOFTWAREGLU E:79 , BCN E:203 , HOH E:306 , GLU I:79binding site for residue CA E 202
27AE9SOFTWAREGLU E:79 , CA E:202 , HOH E:306 , HOH E:309 , HOH E:312 , HOH E:330 , ALA H:80 , LYS H:81 , ASN H:103 , TYR I:76 , LEU I:77 , GLU I:79 , HOH I:1319binding site for residue BCN E 203
28AF1SOFTWAREHOH A:378 , GLU E:51 , GLN E:56 , HIS E:57 , GLN E:61 , TRP E:88 , ASN E:90 , LYS E:91 , GLA E:205 , HOH E:311 , HOH E:321 , HOH E:345 , HOH E:378binding site for residue GAL E 204
29AF2SOFTWAREHOH A:378 , GLU E:51 , GLN E:56 , HIS E:57 , GLN E:61 , TRP E:88 , ASN E:90 , LYS E:91 , GAL E:204 , HOH E:311 , HOH E:321 , HOH E:345 , HOH E:378binding site for residue GLA E 205
30AF3SOFTWAREHOH D:357 , GLU E:79 , BCN E:201 , GLU I:79binding site for residue CA E 206
31AF4SOFTWAREASN F:14 , GLU F:51 , GLN F:56 , GLN F:61 , TRP F:88 , ASN F:90 , LYS F:91 , GAL F:1202 , HOH F:1313 , HOH F:1319 , HOH F:1330 , HOH F:1386 , HIS G:13binding site for residue GLA F 1201
32AF5SOFTWAREASN F:14 , GLU F:51 , GLN F:56 , GLN F:61 , TRP F:88 , ASN F:90 , LYS F:91 , GLA F:1201 , HOH F:1313 , HOH F:1314 , HOH F:1319 , HOH F:1330 , HOH F:1386binding site for residue GAL F 1202
33AF6SOFTWAREALA D:10 , GLU D:11 , TYR D:12 , HIS D:13 , HOH D:308 , HOH D:368 , HOH D:435 , THR G:6 , GLU G:83 , LYS G:84 , HOH G:383binding site for residue PEG G 201
34AF7SOFTWAREGLU G:51 , GLN G:56 , GLN G:61 , TRP G:88 , ASN G:90 , LYS G:91 , GAL G:203 , HOH G:318 , HOH G:324 , HOH G:352 , HOH G:367 , HOH G:369 , HOH G:396binding site for residue GLA G 202
35AF8SOFTWAREGLU G:51 , GLN G:56 , GLN G:61 , TRP G:88 , ASN G:90 , LYS G:91 , GLA G:202 , HOH G:318 , HOH G:324 , HOH G:367 , HOH G:369 , HOH G:396 , HOH G:410binding site for residue GAL G 203
36AF9SOFTWAREGLU H:51 , GLN H:56 , HIS H:57 , GLN H:61 , TRP H:88 , ASN H:90 , LYS H:91 , GLA H:1202 , HOH H:1304 , HOH H:1316 , HOH H:1317 , HOH H:1341 , HOH H:1347 , HOH H:1362binding site for residue GAL H 1201
37AG1SOFTWAREGLU H:51 , GLN H:56 , HIS H:57 , GLN H:61 , TRP H:88 , ASN H:90 , LYS H:91 , GAL H:1201 , HOH H:1304 , HOH H:1316 , HOH H:1317 , HOH H:1341 , HOH H:1347binding site for residue GLA H 1202
38AG2SOFTWAREGLU I:51 , GLN I:56 , HIS I:57 , GLN I:61 , TRP I:88 , ASN I:90 , LYS I:91 , GLA I:1202 , HOH I:1308 , HOH I:1322 , HOH I:1375 , HOH I:1388 , HOH I:1395binding site for residue GAL I 1201
39AG3SOFTWAREGLU I:51 , GLN I:56 , GLN I:61 , TRP I:88 , ASN I:90 , LYS I:91 , GAL I:1201 , HOH I:1308 , HOH I:1322 , HOH I:1375 , HOH I:1388 , HOH I:1395binding site for residue GLA I 1202
40AG4SOFTWAREASN A:90 , LYS A:91 , GLY I:45 , THR I:47 , GAL I:1203 , FUC I:1205 , FUC I:1206 , NDG I:1207 , HOH I:1304 , HOH I:1351 , HOH I:1353 , HOH I:1355binding site for residue NAG I 1204
41AG5SOFTWAREHOH F:1379 , GLU J:51 , GLN J:56 , HIS J:57 , GLN J:61 , TRP J:88 , ASN J:90 , LYS J:91 , GLA J:1202 , HOH J:1301 , HOH J:1308 , HOH J:1314 , HOH J:1425binding site for residue GAL J 1201
42AG6SOFTWAREHOH F:1379 , GLU J:51 , GLN J:56 , HIS J:57 , GLN J:61 , TRP J:88 , ASN J:90 , LYS J:91 , GAL J:1201 , HOH J:1301 , HOH J:1308 , HOH J:1314 , HOH J:1425binding site for residue GLA J 1202
43AG7SOFTWAREASN B:90 , LYS B:91 , GLN I:3 , GLY J:45 , THR J:47 , GAL J:1203 , FUC J:1205 , FUC J:1206 , NDG J:1207 , HOH J:1322 , HOH J:1340 , HOH J:1398 , HOH J:1410binding site for residue NAG J 1204
44AG8SOFTWAREHIS A:18 , ASN A:44 , GLY A:45 , ALA A:46 , THR A:47 , PRO A:93 , HIS A:94 , HOH A:308 , HOH A:311 , HOH A:313 , HOH A:317 , HOH A:320 , HOH A:354 , HOH A:372 , HOH A:382 , HOH A:386 , THR D:19 , LYS D:84 , HOH D:403 , GLN E:3binding site for Poly-Saccharide residues GAL A 207 through FUC A 210
45AG9SOFTWAREGLN A:3 , HIS A:18 , ASN A:44 , GLY A:45 , ALA A:46 , THR A:47 , PRO A:93 , HIS A:94 , HOH A:308 , HOH A:311 , HOH A:313 , HOH A:317 , HOH A:320 , HOH A:354 , HOH A:372 , HOH A:382 , HOH A:386 , GLN B:16 , HIS B:18 , ASN B:44 , GLY B:45 , ALA B:46 , THR B:47 , THR B:92 , PRO B:93 , HIS B:94 , HOH B:302 , HOH B:313 , HOH B:321 , HOH B:322 , HOH B:326 , HOH B:334 , HOH B:339 , HOH B:340 , HOH B:371 , HOH B:382 , HOH B:400 , HOH B:414 , THR C:19 , LYS C:84 , THR D:19 , LYS D:84 , HOH D:403 , GLN E:3 , HOH J:1431binding site for Poly-Saccharide residues GAL B 207 through FUC B 210
46AH1SOFTWAREGLN A:3 , GLN B:3 , GLN B:16 , HIS B:18 , ASN B:44 , GLY B:45 , ALA B:46 , THR B:47 , THR B:92 , PRO B:93 , HIS B:94 , HOH B:302 , HOH B:313 , HOH B:321 , HOH B:322 , HOH B:326 , HOH B:334 , HOH B:339 , HOH B:340 , HOH B:371 , HOH B:382 , HOH B:400 , HOH B:414 , GLN C:16 , HIS C:18 , THR C:19 , ASN C:44 , GLY C:45 , ALA C:46 , THR C:47 , PHE C:48 , LYS C:84 , THR C:92 , PRO C:93 , HIS C:94 , HOH C:302 , HOH C:303 , HOH C:310 , HOH C:311 , HOH C:324 , HOH C:336 , HOH C:368 , HOH C:411 , HOH C:415 , HOH J:1431binding site for Poly-Saccharide residues GAL C 207 through FUC C 210
47AH2SOFTWAREGLN B:3 , GLN C:3 , GLN C:16 , HIS C:18 , ASN C:44 , GLY C:45 , ALA C:46 , THR C:47 , PHE C:48 , THR C:92 , PRO C:93 , HIS C:94 , HOH C:302 , HOH C:303 , HOH C:310 , HOH C:311 , HOH C:324 , HOH C:336 , HOH C:368 , HOH C:411 , HOH C:415 , ASN D:44 , GLY D:45 , ALA D:46 , THR D:47 , THR D:92 , PRO D:93 , HIS D:94 , HOH D:304 , HOH D:305 , HOH D:315 , THR E:6 , LYS E:84 , HOH E:326 , HOH E:387 , HOH E:436binding site for Poly-Saccharide residues GAL D 207 through FUC D 210
48AH3SOFTWAREGLN C:3 , GLN D:3 , ASN D:44 , GLY D:45 , ALA D:46 , THR D:47 , THR D:92 , PRO D:93 , HIS D:94 , HOH D:304 , HOH D:305 , HOH D:315 , THR E:6 , GLN E:16 , HIS E:18 , ASN E:44 , GLY E:45 , ALA E:46 , THR E:47 , PHE E:48 , LYS E:84 , PRO E:93 , HIS E:94 , HOH E:320 , HOH E:326 , HOH E:344 , HOH E:379 , HOH E:387 , HOH E:390 , HOH E:407 , HOH E:436binding site for Poly-Saccharide residues GAL E 207 through FUC E 210
49AH4SOFTWAREGLN D:3 , GLN E:16 , HIS E:18 , ASN E:44 , GLY E:45 , ALA E:46 , THR E:47 , PHE E:48 , PRO E:93 , HIS E:94 , HOH E:320 , HOH E:344 , HOH E:379 , HOH E:390 , HOH E:407 , HIS F:18 , ASN F:44 , GLY F:45 , ALA F:46 , THR F:47 , PRO F:93 , HIS F:94 , HOH F:1316 , HOH F:1340 , HOH F:1380 , HOH F:1395 , GLN J:3binding site for Poly-Saccharide residues GAL F 1203 through FUC F 1206
50AH5SOFTWAREASN C:90 , HOH C:387 , GLN F:3 , HIS F:18 , ASN F:44 , GLY F:45 , ALA F:46 , THR F:47 , PRO F:93 , HIS F:94 , FUC F:1206 , HOH F:1316 , HOH F:1395 , GLN G:16 , HIS G:18 , ASN G:44 , GLY G:45 , ALA G:46 , THR G:47 , PRO G:93 , HIS G:94 , HOH G:302 , HOH G:310 , HOH G:316 , HOH G:317 , HOH G:321 , HOH G:331 , HOH G:355 , HOH G:356 , HOH G:361 , HOH G:402 , GLN J:3binding site for Poly-Saccharide residues GAL G 204 through FUC G 207
51AH6SOFTWAREASN C:90 , HOH C:387 , ASN D:14 , ASN D:90 , HOH D:340 , GLN F:3 , GLN G:3 , HIS G:18 , ASN G:44 , GLY G:45 , ALA G:46 , THR G:47 , PRO G:93 , HIS G:94 , FUC G:207 , HOH G:310 , HOH G:316 , HOH G:317 , HOH G:331 , HOH G:355 , HOH G:356 , HOH G:361 , HOH G:402 , GLN H:16 , HIS H:18 , ASN H:44 , GLY H:45 , ALA H:46 , THR H:47 , PHE H:48 , PRO H:93 , HIS H:94 , HOH H:1303 , HOH H:1321 , HOH H:1363 , HOH H:1384binding site for Poly-Saccharide residues GAL H 1203 through FUC H 1206
52AH7SOFTWAREASN A:90 , LYS A:91 , THR A:92 , HOH A:301 , HOH A:437 , ASN D:14 , ASN D:90 , HOH D:340 , HOH E:394 , GLN G:3 , GLN H:3 , GLN H:16 , HIS H:18 , ASN H:44 , GLY H:45 , ALA H:46 , THR H:47 , PHE H:48 , PRO H:93 , HIS H:94 , HOH H:1303 , HOH H:1321 , HOH H:1363 , HOH H:1384 , HIS I:18 , ASN I:44 , GLY I:45 , ALA I:46 , THR I:47 , PHE I:48 , PRO I:93 , HIS I:94 , HOH I:1304 , HOH I:1323 , HOH I:1326 , HOH I:1330 , HOH I:1331 , HOH I:1332 , HOH I:1351 , HOH I:1353 , HOH I:1355 , HOH I:1392 , HOH I:1402 , HOH I:1409 , HOH I:1415binding site for Poly-Saccharide residues GAL I 1203 through NDG I 1207
53AH8SOFTWAREASN A:90 , LYS A:91 , THR A:92 , HOH A:301 , HOH A:348 , HOH A:416 , HOH A:437 , ASN B:90 , LYS B:91 , THR B:92 , HOH B:301 , HOH E:394 , GLN H:3 , GLN I:3 , HIS I:18 , ASN I:44 , GLY I:45 , ALA I:46 , THR I:47 , PHE I:48 , PRO I:93 , HIS I:94 , NAG I:1204 , HOH I:1304 , HOH I:1323 , HOH I:1326 , HOH I:1330 , HOH I:1331 , HOH I:1332 , HOH I:1351 , HOH I:1353 , HOH I:1355 , HOH I:1392 , HOH I:1402 , HOH I:1409 , HOH I:1415 , GLN J:16 , HIS J:18 , ASN J:44 , GLY J:45 , ALA J:46 , THR J:47 , PHE J:48 , PRO J:93 , HIS J:94 , NAG J:1204 , HOH J:1305 , HOH J:1306 , HOH J:1307 , HOH J:1309 , HOH J:1311 , HOH J:1322 , HOH J:1340 , HOH J:1358 , HOH J:1385 , HOH J:1391 , HOH J:1396 , HOH J:1398binding site for Poly-Saccharide residues GAL J 1203 through NDG J 1207

(-) SS Bonds  (10, 10)

Asymmetric Unit
No.Residues
1A:9 -A:86
2B:9 -B:86
3C:9 -C:86
4D:9 -D:86
5E:9 -E:86
6F:9 -F:86
7G:9 -G:86
8H:9 -H:86
9I:9 -I:86
10J:9 -J:86

(-) Cis Peptide Bonds  (10, 11)

Asymmetric Unit
No.Residues
1Thr A:92 -Pro A:93
2Thr B:92 -Pro B:93
3Thr C:92 -Pro C:93
4Thr D:92 -Pro D:93
5Thr E:92 -Pro E:93
6Thr F:92 -Pro F:93
7Thr G:92 -Pro G:93
8Thr H:92 -Pro H:93
9Thr I:92 -Pro I:93
10Thr J:92 -Pro J:93

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5ELB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5ELB)

(-) Exons   (0, 0)

(no "Exon" information available for 5ELB)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh....eeeeeeeee..eeeee......eeeee.....eeee.......hhhhhhhhhhhhhhhhhhhhhh.eeeeeeee.....eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elb A   1 TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain B from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh.................................................hhhhhhhhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elb B   1 TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain C from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh.................................................hhhhhhhhhhhhhhhhhhh......................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elb C   1 TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain D from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..............................................hhhhhhhhhhhhhhhhhhhh.......................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elb D   1 TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain E from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh.................................................hhhhhhhhhhhhhhhhhhh...............eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elb E   1 TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain F from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh....eeeeeeee...eeeee......eeeee.....eeee.........hhhhhhhhhhhhhhhhhhh...eeeeeee.....eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elb F   1 TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain G from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..............................................hhhhhhhhhhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elb G   1 TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain H from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh.................................................hhhhhhhhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elb H   1 TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain I from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh................................................hhhhhhhhhhhhhhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elb I   1 TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100   


Chain J from PDB  Type:PROTEIN  Length:103
                                                                                                                                       
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhh...............................................hhhhhhhhhhhhhhhhhhhhhh..............eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 5elb J   1 TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN 103
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5ELB)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5ELB)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5ELB)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BCN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FUC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GAL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GLA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NDG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
    AG5  [ RasMol ]  +environment [ RasMol ]
    AG6  [ RasMol ]  +environment [ RasMol ]
    AG7  [ RasMol ]  +environment [ RasMol ]
    AG8  [ RasMol ]  +environment [ RasMol ]
    AG9  [ RasMol ]  +environment [ RasMol ]
    AH1  [ RasMol ]  +environment [ RasMol ]
    AH2  [ RasMol ]  +environment [ RasMol ]
    AH3  [ RasMol ]  +environment [ RasMol ]
    AH4  [ RasMol ]  +environment [ RasMol ]
    AH5  [ RasMol ]  +environment [ RasMol ]
    AH6  [ RasMol ]  +environment [ RasMol ]
    AH7  [ RasMol ]  +environment [ RasMol ]
    AH8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Thr A:92 - Pro A:93   [ RasMol ]  
    Thr B:92 - Pro B:93   [ RasMol ]  
    Thr C:92 - Pro C:93   [ RasMol ]  
    Thr D:92 - Pro D:93   [ RasMol ]  
    Thr E:92 - Pro E:93   [ RasMol ]  
    Thr F:92 - Pro F:93   [ RasMol ]  
    Thr G:92 - Pro G:93   [ RasMol ]  
    Thr H:92 - Pro H:93   [ RasMol ]  
    Thr I:92 - Pro I:93   [ RasMol ]  
    Thr J:92 - Pro J:93   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5elb
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q57193_VIBCL | Q57193
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q57193_VIBCL | Q57193
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q57193_VIBCL | Q57193: 5eld 5lzh
UniProtKB/TrEMBL
        Q57193_VIBCL | Q57193: 1eei 1llr 1pzj 1pzk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5ELB)