Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  DEVELOPMENT OF A NOVEL TRICYCLIC CLASS OF POTENT AND SELECTIVE FIXA INHIBITORS
 
Authors :  D. Meng, P. Andre, T. J. Bateman, R. Berger, Y. Chen, K. Desai, S. Dewnani K. Ellsworth, D. Feng, W. M. Geissler, L. Guo, A. Hruza, T. Jian, H. Li, D. L. Parker, P. Reichert, E. C. Sherer, C. J. Smith, L. M. Sonatore, R. T Guth, J. Wu, J. Xu, T. Zhang, L. Campeau, R. Orr, M. Poirier, J. Mccabe-D K. Araki, T. Nishimura, I. Sakurada, T. Hirabayashi, H. B. Wood
Date :  27 Oct 15  (Deposition) - 18 Nov 15  (Release) - 18 Nov 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.84
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Serine Proteinase, Blood Coagulation, Coagulation Factor, Hydrolase-2 Hydrolase Inhibitor Complex, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Meng, P. Andre, T. J. Bateman, R. Berger, Y. H. Chen, K. Desai, S. Dewnani, K. Ellsworth, D. Feng, W. M. Geissler, L. Guo, A. Hruza, T. Jian, H. Li, J. Metzger, D. L. Parker, P. Reichert, E. C. Sherer, C. J. Smith, L. M. Sonatore, R. Tschirret-Guth, J. Wu, J. Xu, T. Zhang, L. C. Campeau, R. Orr, M. Poirier, J. Mccabe-Dunn, K. Araki, T. Nishimura, I. Sakurada, T. Hirabayashi, H. B. Wood
Development Of A Novel Tricyclic Class Of Potent And Selective Fixa Inhibitors.
Bioorg. Med. Chem. Lett. V. 25 5437 2015
PubMed-ID: 26318999  |  Reference-DOI: 10.1016/J.BMCL.2015.07.078

(-) Compounds

Molecule 1 - COAGULATION FACTOR IX
    Chains: A
    EC Number: 3.4.21.22
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: F9
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CHRISTMAS FACTOR,PLASMA THROMBOPLASTIN COMPONENT,PTC
 
Molecule 2 - COAGULATION FACTOR IX
    Chains: B
    EC Number: 3.4.21.22
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 131-191
    Gene: F9
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CHRISTMAS FACTOR,PLASMA THROMBOPLASTIN COMPONENT,PTC

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric/Biological Unit (3, 3)
No.NameCountTypeFull Name
15NY1Ligand/Ion2-CHLORANYL-~{N}-[(7~{S})-2-METHYL-7-PHENYL-10-(1~{H}-1,2,3,4-TETRAZOL-5-YL)-8,9-DIHYDRO-6~{H}-PYRIDO[1,2-A]INDOL-7-YL]-4-(1,2,4-TRIAZOL-4-YL)BENZAMIDE
2NA1Ligand/IonSODIUM ION
3NHE1Ligand/Ion2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:70 , ASN A:72 , GLU A:75 , GLU A:77 , GLU A:80 , HOH A:422binding site for residue NA A 301
2AC2SOFTWAREASP A:21 , LYS A:132 , PHE A:145 , ALA A:152 , LEU A:153 , VAL A:154 , HOH A:436 , HOH A:454binding site for residue NHE A 302
3AC3SOFTWAREHIS A:57 , TYR A:99 , HIS A:147 , PHE A:174 , SER A:190 , CYS A:191 , GLN A:192 , SER A:195 , ILE A:213 , TRP A:215 , GLY A:216 , GLU A:217 , CYS A:220 , HOH A:448 , HOH A:478binding site for residue 5NY A 303

(-) SS Bonds  (7, 7)

Asymmetric/Biological Unit
No.Residues
1A:42 -A:58
2A:122 -B:132
3A:168 -A:182
4A:191 -A:220
5B:88 -B:99
6B:95 -B:109
7B:111 -B:124

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5EGM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5EGM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5EGM)

(-) Exons   (0, 0)

(no "Exon" information available for 5EGM)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:235
                                                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee......eeeeeee..eeeehhhhh......eeee............eeeeeeeeee...............eeeee................hhhhhhhhhhh.eeeeee..............eeeeeeeehhhhhhhh........eeee................eeeeee..eeeeeeeeee..........eeeee...hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5egm A   16 VVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVFHKGASALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT  245
                                    25        35||      46        56    |   65        75        85        95||     103       113       123      |131       141   ||  152       162       172       182  |    190       200       210      |221|      230       240     
                                               36|                    60A                                 95A|                               129A|             145|                                  184A 188A                          217|  |                        
                                                38                                                         95B                                129B              147                                                                      219  |                        
                                                                                                                                                                                                                                           221A                        


Chain B from PDB  Type:PROTEIN  Length:54
                                                                                       
               SCOP domains ------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhh..eeeee...eeeee....eee......eee............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------ Transcript
                5egm B   86 VTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQ  139
                                    95       105       115       125       135
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5EGM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5EGM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5EGM)

(-) Gene Ontology  (22, 22)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5NY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NHE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5egm)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5egm
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FA9_HUMAN | P00740
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.22
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FA9_HUMAN | P00740
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FA9_HUMAN | P00740: 1cfh 1cfi 1edm 1ixa 1mgx 1nl0 1rfn 2wph 2wpi 2wpj 2wpk 2wpl 2wpm 3kcg 3lc3 3lc5 4wm0 4wma 4wmb 4wmi 4wmk 4wn2 4wnh 4yzu 4z0k 4zae 5f84 5f85 5f86 5jb8 5jb9 5jba 5jbb 5jbc 5tno 5tnt

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5EGM)