Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  MONOCLINIC STRUCTURE OF THE ACETYL ESTERASE MEKB
 
Authors :  C. Toelzer, S. Pal, H. Watzlawick, J. Altenbuchner, K. Niefind
Date :  26 Oct 15  (Deposition) - 16 Dec 15  (Release) - 03 Feb 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.82
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,E  (1x)
Biol. Unit 3:  D,F  (1x)
Keywords :  Alpha/Beta Hydrolase, Acetyl Ester Hydrolase, Pseudomonas Veronii, Transferase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Tolzer, S. Pal, H. Watzlawick, J. Altenbuchner, K. Niefind
A Novel Esterase Subfamily With Alpha / Beta-Hydrolase Fold Suggested By Structures Of Two Bacterial Enzymes Homologous To L-Homoserine O-Acetyl Transferases.
Febs Lett. V. 590 174 2016
PubMed-ID: 26787467  |  Reference-DOI: 10.1002/1873-3468.12031

(-) Compounds

Molecule 1 - HOMOSERINE O-ACETYLTRANSFERASE
    Chains: A, B, C, D, E, F
    EC Number: 2.3.1.-, 2.3.1.31
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: MEKB
    Organism Scientific: PSEUDOMONAS VERONII
    Organism Taxid: 76761
    Synonym: HYDROLASE

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): AB    
Biological Unit 2 (1x):   C E 
Biological Unit 3 (1x):    D F

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 40)

Asymmetric Unit (3, 40)
No.NameCountTypeFull Name
1ACT7Ligand/IonACETATE ION
2EDO25Ligand/Ion1,2-ETHANEDIOL
3GOL8Ligand/IonGLYCEROL
Biological Unit 1 (3, 15)
No.NameCountTypeFull Name
1ACT2Ligand/IonACETATE ION
2EDO12Ligand/Ion1,2-ETHANEDIOL
3GOL1Ligand/IonGLYCEROL
Biological Unit 2 (3, 13)
No.NameCountTypeFull Name
1ACT3Ligand/IonACETATE ION
2EDO8Ligand/Ion1,2-ETHANEDIOL
3GOL2Ligand/IonGLYCEROL
Biological Unit 3 (3, 12)
No.NameCountTypeFull Name
1ACT2Ligand/IonACETATE ION
2EDO5Ligand/Ion1,2-ETHANEDIOL
3GOL5Ligand/IonGLYCEROL

(-) Sites  (40, 40)

Asymmetric Unit (40, 40)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETYR A:5 , GLY A:90 , LEU A:91 , ASN A:97binding site for residue EDO A 401
02AC2SOFTWAREASP A:299 , LYS A:306 , HOH A:563binding site for residue EDO A 402
03AC3SOFTWARESER A:47 , ARG A:158 , ALA A:348 , HOH A:532 , ASP F:45binding site for residue EDO A 403
04AC4SOFTWARETHR A:184 , THR A:185 , ASP A:186 , PRO A:187 , GLN A:190 , ALA A:191 , HOH A:565binding site for residue EDO A 404
05AC5SOFTWAREARG A:167 , ASN A:168 , GLN A:262binding site for residue EDO A 405
06AC6SOFTWAREGLY A:104 , PRO A:105 , PHE A:107 , ASN A:252 , THR A:256 , HOH A:528 , HOH A:549binding site for residue EDO A 406
07AC7SOFTWAREARG A:167 , SER A:169 , LEU A:274 , GLU A:304 , HOH A:531binding site for residue EDO A 407
08AC8SOFTWAREALA A:188 , ARG A:195binding site for residue GOL A 408
09AC9SOFTWARETRP A:55 , TYR A:56 , SER A:139 , MET A:140 , HIS A:322binding site for residue ACT A 409
10AD1SOFTWAREARG B:72 , ASP B:334binding site for residue EDO B 401
11AD2SOFTWAREARG B:27 , SER B:101 , SER E:101binding site for residue EDO B 402
12AD3SOFTWARELYS B:46 , HOH B:505 , HOH B:596binding site for residue EDO B 403
13AD4SOFTWARESER B:291binding site for residue EDO B 404
14AD5SOFTWAREARG B:263binding site for residue EDO B 405
15AD6SOFTWARETRP B:55 , TYR B:56 , SER B:139 , MET B:140 , HIS B:322binding site for residue ACT B 406
16AD7SOFTWAREARG C:195 , EDO C:406 , GOL C:407 , GLN D:294 , HOH D:561 , GLN F:294binding site for residue EDO C 401
17AD8SOFTWAREARG C:167 , SER C:169 , LEU C:274 , ASP C:300 , GLU C:304 , HOH C:510 , HOH C:547binding site for residue EDO C 402
18AD9SOFTWAREGLY C:104 , PRO C:105 , PHE C:107 , ASN C:252 , LEU C:255 , THR C:256 , HOH C:537 , HOH C:546binding site for residue EDO C 403
19AE1SOFTWAREGLU C:25 , ARG C:27 , PHE C:107 , ASN C:109 , HOH C:512 , HOH C:525 , HOH C:531 , GLU F:312binding site for residue EDO C 404
20AE2SOFTWAREASP C:299 , LYS C:306 , HOH C:506 , ARG E:222binding site for residue EDO C 405
21AE3SOFTWAREGLN C:190 , EDO C:401 , SER F:291 , ASP F:293 , HOH F:510 , HOH F:572binding site for residue EDO C 406
22AE4SOFTWAREGLN C:190 , ARG C:195 , EDO C:401 , HOH C:515 , SER D:291binding site for residue GOL C 407
23AE5SOFTWAREARG C:195 , SER C:196 , ALA C:199 , VAL D:298 , PRO D:315binding site for residue GOL C 408
24AE6SOFTWARETRP C:55 , TYR C:56 , SER C:139 , MET C:140 , HIS C:322binding site for residue ACT C 409
25AE7SOFTWARESER D:169 , HIS D:171 , PHE D:295 , ASP D:300 , HOH D:501 , HOH D:566 , PRO F:218 , ARG F:222binding site for residue EDO D 401
26AE8SOFTWARESER D:303 , LYS D:306 , HOH D:519 , ARG F:222binding site for residue EDO D 402
27AE9SOFTWAREARG D:222 , HOH D:601 , ASP F:299binding site for residue EDO D 403
28AF1SOFTWAREARG D:27 , PRO D:105 , PHE D:107 , ALA D:108 , ASN D:109 , HOH D:518 , HOH D:555binding site for residue GOL D 404
29AF2SOFTWAREILE D:178 , ALA D:182 , LEU D:210 , HOH D:523 , HOH D:537 , ILE F:178 , ALA F:182binding site for residue GOL D 405
30AF3SOFTWARETRP D:55 , TYR D:56 , SER D:139 , MET D:140 , HIS D:322binding site for residue ACT D 406
31AF4SOFTWAREARG E:167 , LEU E:274 , GLU E:304binding site for residue EDO E 401
32AF5SOFTWAREGLU E:312 , HOH E:509 , HOH E:514binding site for residue EDO E 402
33AF6SOFTWARETRP E:55 , TYR E:56 , SER E:139 , MET E:140 , HIS E:322binding site for residue ACT E 403
34AF7SOFTWAREILE C:178 , ALA C:182 , LEU E:210binding site for residue ACT E 404
35AF8SOFTWAREARG F:167 , GLY F:272 , ASP F:273 , LEU F:274 , ALA F:275binding site for residue EDO F 401
36AF9SOFTWAREGLU F:177 , HOH F:525binding site for residue EDO F 402
37AG1SOFTWAREARG F:167 , SER F:169 , LEU F:274 , ASP F:300 , SER F:303 , GLU F:304 , HOH F:504 , HOH F:520binding site for residue GOL F 403
38AG2SOFTWARESER A:47 , HOH A:522 , ASN F:43 , ASP F:45 , SER F:47 , HOH F:506binding site for residue GOL F 404
39AG3SOFTWAREASN A:43 , ALA A:44 , ASP A:45 , SER A:47 , HOH F:506binding site for residue GOL F 405
40AG4SOFTWARETRP F:55 , TYR F:56 , SER F:139 , MET F:140 , HIS F:322binding site for residue ACT F 406

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5EFZ)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Gly A:11 -Pro A:12
2Gly B:11 -Pro B:12
3Gly C:11 -Pro C:12
4Gly D:11 -Pro D:12
5Gly E:11 -Pro E:12
6Gly F:11 -Pro F:12

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5EFZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5EFZ)

(-) Exons   (0, 0)

(no "Exon" information available for 5EFZ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:347
                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh..eeee...ee.....ee...eeeeeee.........eeeee.....hhhhhhhhhh...........eeeee..............hhhhhhhhh...hhhhhhhhhhhhhhhh.......eeeeehhhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhh....eeeee........hhhhhhhhhh.....ee......hhhhhhhh.hhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5efz A   3 SYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAILVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGGSLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAVRYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAVAAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMDPNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDDCLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSPAY 349
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       


Chain B from PDB  Type:PROTEIN  Length:345
                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh..eeee...ee.....ee...eeeeeee.........eeeee.....hhhhhhhhhh...........eeeee..............hhhhhhhhh...hhhhhhhhhhhhhhhh.......eeeeehhhhhhhhhhhhhhhhhh.eeeee......hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhhhh....eeeee........hhhhhhhhhh.....ee......hhhhhhhh.hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5efz B   3 SYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAILVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGGSLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAVRYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAVAAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMDPNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDDCLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSP 347
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342     


Chain C from PDB  Type:PROTEIN  Length:339
                                                                                                                                                                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee...ee.....ee...eeeeeee.........eeeee.....hhhhhhhhhh...........eeeee..............hhhhhhhhh...hhhhhhhhhhhhhhhh.......eeeeehhhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh...eeeee........hhhhhhhhhh.....ee......hhhhhhhh.hhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5efz C  10 HGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAILVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGGSLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAVRYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAVAAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMDPNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDDCLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSPA 348
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339         


Chain D from PDB  Type:PROTEIN  Length:345
                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhh..eeee...ee.....ee...eeeeeee.........eeeee.....hhhhhhhhhh...........eeeee..............hhhhhhhhh...hhhhhhhhhhhhhhhh.......eeeeehhhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhh....eeeee........hhhhhhhhhh.....ee......hhhhhhhh.hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5efz D   2 NSYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAILVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGGSLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAVRYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAVAAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMDPNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDDCLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSS 346
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341     


Chain E from PDB  Type:PROTEIN  Length:345
                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh..eeee...ee.....ee...eeeeeee.........eeeee.....hhhhhhhhhh...........eeeee..............hhhhhhhhh...hhhhhhhhhhhhhhhh.......eeeeehhhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhhh...hhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh...eeeee........hhhhhhhhhh.....ee......hhhhhhhh.hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5efz E   3 SYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAILVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGGSLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAVRYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAVAAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMDPNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDDCLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSP 347
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342     


Chain F from PDB  Type:PROTEIN  Length:347
                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh..eeee...ee.....ee...eeeeeee.........eeeee.....hhhhhhhhhh...........eeeee..............hhhhhhhhh...hhhhhhhhhhhhhhhh.......eeeeehhhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhh....eeeee........hhhhhhhhhh.....ee......hhhhhhhh.hhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5efz F   3 SYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAILVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGGSLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAVRYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAVAAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMDPNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDDCLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSPAY 349
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5EFZ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5EFZ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5EFZ)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
    AE8  [ RasMol ]  +environment [ RasMol ]
    AE9  [ RasMol ]  +environment [ RasMol ]
    AF1  [ RasMol ]  +environment [ RasMol ]
    AF2  [ RasMol ]  +environment [ RasMol ]
    AF3  [ RasMol ]  +environment [ RasMol ]
    AF4  [ RasMol ]  +environment [ RasMol ]
    AF5  [ RasMol ]  +environment [ RasMol ]
    AF6  [ RasMol ]  +environment [ RasMol ]
    AF7  [ RasMol ]  +environment [ RasMol ]
    AF8  [ RasMol ]  +environment [ RasMol ]
    AF9  [ RasMol ]  +environment [ RasMol ]
    AG1  [ RasMol ]  +environment [ RasMol ]
    AG2  [ RasMol ]  +environment [ RasMol ]
    AG3  [ RasMol ]  +environment [ RasMol ]
    AG4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:11 - Pro A:12   [ RasMol ]  
    Gly B:11 - Pro B:12   [ RasMol ]  
    Gly C:11 - Pro C:12   [ RasMol ]  
    Gly D:11 - Pro D:12   [ RasMol ]  
    Gly E:11 - Pro E:12   [ RasMol ]  
    Gly F:11 - Pro F:12   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5efz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q0MRG5_9PSED | Q0MRG5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  2.3.1.31
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q0MRG5_9PSED | Q0MRG5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q0MRG5_9PSED | Q0MRG5: 5e4y

(-) Related Entries Specified in the PDB File

5e4y 5E4Y CONTAINS THE SAME PROTEIN IN OTHER CRYSTAL FORM.