Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN CARBONIC ANHYDRASE ISOZYME I WITH 3-(CYCLOOCTYLAMINO)-2,5,6-TRIFLUORO-4-[(2-HYDROXYETHYL) SULFONYL]BENZENESULFONAMIDE
 
Authors :  E. Manakova, A. Smirnov, S. Grazulis
Date :  01 Oct 15  (Deposition) - 05 Oct 16  (Release) - 01 Feb 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.41
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Drug Design, Carbonic Anhydrase, Benzenesulfonamide, Metal-Binding, Lyase-Lyase Inhibitor Complex, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Zubriene, A. Smirnov, V. Dudutiene, D. D. Timm, J. Matuliene, V. Michailoviene, A. Zaksauskas, E. Manakova, S. Grazulis, D. Matuli
Intrinsic Thermodynamics And Structures Of 2, 4- And 3, 4-Substituted Fluorinated Benzenesulfonamides Binding To Carbonic Anhydrases.
Chemmedchem V. 12 161 2017
PubMed-ID: 28001003  |  Reference-DOI: 10.1002/CMDC.201600509

(-) Compounds

Molecule 1 - CARBONIC ANHYDRASE 1
    Chains: A, B
    EC Number: 4.2.1.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET15B
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: HUMAN CARBONIC ANHYDRASE I
    Gene: CA1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CARBONATE DEHYDRATASE I,CARBONIC ANHYDRASE B,CAB,CARBONIC ANHYDRASE I,CA-I

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 7)

Asymmetric Unit (4, 7)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2PEG2Ligand/IonDI(HYDROXYETHYL)ETHER
3V142Ligand/Ion3-(CYCLOOCTYLAMINO)-2,5,6-TRIFLUORO-4-[(2-HYDROXYETHYL)SULFONYL]BENZENESULFONAMIDE
4ZN2Ligand/IonZINC ION
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2PEG-1Ligand/IonDI(HYDROXYETHYL)ETHER
3V141Ligand/Ion3-(CYCLOOCTYLAMINO)-2,5,6-TRIFLUORO-4-[(2-HYDROXYETHYL)SULFONYL]BENZENESULFONAMIDE
4ZN-1Ligand/IonZINC ION
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
1ACT-1Ligand/IonACETATE ION
2PEG2Ligand/IonDI(HYDROXYETHYL)ETHER
3V141Ligand/Ion3-(CYCLOOCTYLAMINO)-2,5,6-TRIFLUORO-4-[(2-HYDROXYETHYL)SULFONYL]BENZENESULFONAMIDE
4ZN-1Ligand/IonZINC ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:94 , HIS A:96 , HIS A:119 , V14 A:302binding site for residue ZN A 301
2AC2SOFTWAREHIS A:64 , HIS A:67 , PHE A:91 , HIS A:94 , HIS A:96 , HIS A:119 , LEU A:131 , ALA A:135 , LEU A:198 , THR A:199 , HIS A:200 , PRO A:201 , PRO A:202 , TRP A:209 , ZN A:301 , ACT A:303 , HOH A:489 , HOH A:518 , ALA B:132binding site for residue V14 A 302
3AC3SOFTWARETYR A:204 , V14 A:302 , HOH A:402 , TYR B:204binding site for residue ACT A 303
4AC4SOFTWAREHIS B:94 , HIS B:96 , HIS B:119 , V14 B:302binding site for residue ZN B 301
5AC5SOFTWAREHIS B:64 , HIS B:67 , GLN B:92 , HIS B:94 , HIS B:96 , HIS B:119 , ALA B:135 , LEU B:198 , THR B:199 , HIS B:200 , PRO B:201 , PRO B:202 , ZN B:301 , HOH B:591binding site for residue V14 B 302
6AC6SOFTWARELYS A:172 , HOH A:413 , HOH A:415 , ASN B:52 , PRO B:53 , ALA B:54 , ASN B:178binding site for residue PEG B 303
7AC7SOFTWAREASP B:74 , ASN B:75 , ARG B:76 , ALA B:153 , PRO B:155 , GLN B:158 , HOH B:506 , HOH B:602binding site for residue PEG B 304
8AC8SOFTWAREPHE B:70 , GLU B:71 , ASN B:73 , ASP B:74 , ASN B:75 , SER B:77 , TYR B:88 , LEU B:90 , PHE B:91 , HIS B:122 , TRP B:123 , HOH B:401 , HOH B:430 , HOH B:567 , HOH B:569binding site for Di-peptide ASP B 72 and ARG B 89

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5E2M)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Ser A:29 -Pro A:30
2Pro A:201 -Pro A:202
3Ser B:29 -Pro B:30
4Pro B:201 -Pro B:202

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5E2M)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5E2M)

(-) Exons   (0, 0)

(no "Exon" information available for 5E2M)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:256
                                                                                                                                                                                                                                                                                                
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhh......eehhhhhee......eeee.hhh.eeeeee....eeeee.......eeee......eeeeeeeeee..........ee......eeeeeeeee.....hhhhhh.....eeeeeeeeee...hhhhhhhhhhhhhh.....eee....hhhhhh.....eeeeee..........eeeeee...eeehhhhhhhhhh............................ee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5e2m A   5 WGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF 260
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254      


Chain B from PDB  Type:PROTEIN  Length:257
                                                                                                                                                                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................hhhhhh......eehhhhhee......eeee.hhh.eeeeee....eeeee.......eeee......eeeeeeeeee..........ee......eeeeeeee......hhhhhh.....eeeeeeeeee...hhhhhhhhhhhhhh.....eee....hhhhhh.....eeeeee..........eeeeee...eeehhhhhhhhhh............................ee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5e2m B   4 DWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF 260
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5E2M)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5E2M)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5E2M)

(-) Gene Ontology  (12, 12)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    V14  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:201 - Pro A:202   [ RasMol ]  
    Pro B:201 - Pro B:202   [ RasMol ]  
    Ser A:29 - Pro A:30   [ RasMol ]  
    Ser B:29 - Pro B:30   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5e2m
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAH1_HUMAN | P00915
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CAH1_HUMAN | P00915
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CAH1_HUMAN | P00915: 1azm 1bzm 1crm 1czm 1hcb 1hug 1huh 1j9w 1jv0 2cab 2foy 2fw4 2it4 2nmx 2nn1 2nn7 3lxe 3w6h 3w6i 4wr7 4wup 4wuq 5gmm

(-) Related Entries Specified in the PDB File

5dog 5doh 5drs