Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN CARBONIC ANHYDRASE ISOZYME I WITH 2,3,5,6-TETRAFLUORO-4-(PROPYLTHIO)BENZENESULFONAMIDE.
 
Authors :  E. Manakova, A. Smirnov, S. Grazulis
Date :  23 Oct 14  (Deposition) - 01 Jul 15  (Release) - 01 Jul 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Drug Design, Benzenesulfonamide, Metal-Binding, Lyase-Lyase Inhibitor Complex, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Zubriene, J. Smirnoviene, A. Smirnov, V. Morkunaite, V. Michailoviene, J. Jachno, V. Juozapaitiene, P. Norvaisas, E. Manakova, S. Grazulis, D. Matulis
Intrinsic Thermodynamics Of 4-Substituted-2, 3, 5, 6-Tetrafluorobenzenesulfonamide Binding To Carbonic Anhydrases By Isothermal Titration Calorimetry.
Biophys. Chem. V. 205 51 2015
PubMed-ID: 26079542  |  Reference-DOI: 10.1016/J.BPC.2015.05.009

(-) Compounds

Molecule 1 - CARBONIC ANHYDRASE 1
    Chains: A, B
    EC Number: 4.2.1.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET15B
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 3-261
    Gene: CA1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CARBONATE DEHYDRATASE I,CARBONIC ANHYDRASE B,CAB,CARBONIC ANHYDRASE I,CA-I

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 9)

Asymmetric Unit (5, 9)
No.NameCountTypeFull Name
13TV2Ligand/Ion2,3,5,6-TETRAFLUORO-4-(PROPYLSULFANYL)BENZENESULFONAMIDE
2ACT2Ligand/IonACETATE ION
3EDO2Ligand/Ion1,2-ETHANEDIOL
4PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
5ZN2Ligand/IonZINC ION
Biological Unit 1 (3, 3)
No.NameCountTypeFull Name
13TV1Ligand/Ion2,3,5,6-TETRAFLUORO-4-(PROPYLSULFANYL)BENZENESULFONAMIDE
2ACT1Ligand/IonACETATE ION
3EDO-1Ligand/Ion1,2-ETHANEDIOL
4PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
5ZN-1Ligand/IonZINC ION
Biological Unit 2 (3, 4)
No.NameCountTypeFull Name
13TV1Ligand/Ion2,3,5,6-TETRAFLUORO-4-(PROPYLSULFANYL)BENZENESULFONAMIDE
2ACT1Ligand/IonACETATE ION
3EDO2Ligand/Ion1,2-ETHANEDIOL
4PEG-1Ligand/IonDI(HYDROXYETHYL)ETHER
5ZN-1Ligand/IonZINC ION

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:94 , HIS A:96 , HIS A:119 , 3TV A:302binding site for residue ZN A 301
2AC2SOFTWAREPHE A:91 , HIS A:94 , HIS A:96 , HIS A:119 , ALA A:121 , ALA A:135 , LEU A:198 , THR A:199 , HIS A:200 , PRO A:201 , TRP A:209 , ZN A:301 , HOH A:551binding site for residue 3TV A 302
3AC3SOFTWAREALA A:166 , LYS A:172 , ARG A:173 , ALA A:174 , HOH A:440 , HOH A:459 , TYR B:51 , PRO B:53 , ASP B:180 , HOH B:453binding site for residue PEG A 303
4AC4SOFTWAREHIS A:67 , GLN A:92 , LEU A:131 , HOH A:448binding site for residue ACT A 304
5AC5SOFTWAREHIS B:94 , HIS B:96 , HIS B:119 , 3TV B:302binding site for residue ZN B 301
6AC6SOFTWAREPHE B:91 , HIS B:94 , HIS B:96 , HIS B:119 , ALA B:121 , LEU B:198 , THR B:199 , HIS B:200 , PRO B:201 , TRP B:209 , ZN B:301 , HOH B:568binding site for residue 3TV B 302
7AC7SOFTWAREHOH A:406 , HIS B:67 , ASN B:69 , GLN B:92 , HOH B:434 , HOH B:512 , HOH B:594binding site for residue EDO B 303
8AC8SOFTWARETYR A:204 , TYR B:204 , HOH B:405binding site for residue ACT B 304
9AC9SOFTWAREASP B:41 , SER B:43 , LEU B:44 , PRO B:83 , ARG B:257binding site for residue EDO B 305

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4WR7)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Ser A:29 -Pro A:30
2Pro A:201 -Pro A:202
3Ser B:29 -Pro B:30
4Pro B:201 -Pro B:202

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WR7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WR7)

(-) Exons   (0, 0)

(no "Exon" information available for 4WR7)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:258
                                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhh......eehhhhhee......eeee.hhh.eeeeee....eeeee.......eeee......eeeeeeeeee..........ee......eeeeeeeee.....hhhhhh.....eeeeeeeeee...hhhhhhhhhhhhhh.....eee....hhhhhh.....eeeeee..........eeeeee...eeehhhhhhhhhhh...........................ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4wr7 A   3 PDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF 260
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252        


Chain B from PDB  Type:PROTEIN  Length:257
                                                                                                                                                                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhh......eehhhhhee......eeee.hhh.eeeeee....eeeee.......eeee......eeeeeeeeee..........ee......eeeeeeeee.....hhhhhh.....eeeeeeeeee...hhhhhhhhhhhhhh.....eee....hhhhhh.....eeeeee..........eeeeee...eeehhhhhhhhhhh...........................ee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4wr7 B   4 DWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF 260
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WR7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WR7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WR7)

(-) Gene Ontology  (12, 12)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3TV  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:201 - Pro A:202   [ RasMol ]  
    Pro B:201 - Pro B:202   [ RasMol ]  
    Ser A:29 - Pro A:30   [ RasMol ]  
    Ser B:29 - Pro B:30   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wr7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CAH1_HUMAN | P00915
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CAH1_HUMAN | P00915
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CAH1_HUMAN | P00915: 1azm 1bzm 1crm 1czm 1hcb 1hug 1huh 1j9w 1jv0 2cab 2foy 2fw4 2it4 2nmx 2nn1 2nn7 3lxe 3w6h 3w6i 4wup 4wuq 5e2m 5gmm

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4WR7)