Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  L-GLUTAMINE RIBOSWITCH BOUND WITH L-GLUTAMINE SOAKED WITH MN2+
 
Authors :  A. Ren, D. J. Patel
Date :  25 Aug 15  (Deposition) - 23 Dec 15  (Release) - 05 Apr 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,D  (1x)
Biol. Unit 2:  B,C  (1x)
Keywords :  Riboswitch, L-Glutamine, Bound-Form, Rna, Rna Binding Protein-Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Ren, Y. Xue, A. Peselis, A. Serganov, H. M. Al-Hashimi, D. J. Patel
Structural And Dynamic Basis For Low-Affinity, High-Selectivity Binding Of L-Glutamine By The Glutamine Riboswitch.
Cell Rep V. 13 1800 2015
PubMed-ID: 26655897  |  Reference-DOI: 10.1016/J.CELREP.2015.10.062

(-) Compounds

Molecule 1 - L-GLUTAMINE RIBOSWITCH RNA (61-MER)
    ChainsA, B
    Organism ScientificSYNECHOCOCCUS ELONGATUS
    Organism Taxid32046
 
Molecule 2 - U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
    ChainsC, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneSNRPA
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymU1A

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A  D
Biological Unit 2 (1x) BC 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 22)

Asymmetric Unit (4, 22)
No.NameCountTypeFull Name
1GLN2Mod. Amino AcidGLUTAMINE
2MG3Ligand/IonMAGNESIUM ION
3MN5Ligand/IonMANGANESE (II) ION
4NA12Ligand/IonSODIUM ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1GLN1Mod. Amino AcidGLUTAMINE
2MG-1Ligand/IonMAGNESIUM ION
3MN-1Ligand/IonMANGANESE (II) ION
4NA-1Ligand/IonSODIUM ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1GLN1Mod. Amino AcidGLUTAMINE
2MG-1Ligand/IonMAGNESIUM ION
3MN-1Ligand/IonMANGANESE (II) ION
4NA-1Ligand/IonSODIUM ION

(-) Sites  (21, 21)

Asymmetric Unit (21, 21)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREC A:1 , G A:22 , G A:23 , A A:24 , G A:54 , C A:58 , G A:59 , MN A:102 , HOH A:215 , HOH A:222 , HOH A:223 , HOH A:239 , HOH A:247binding site for residue GLN A 101
02AC2SOFTWAREG A:54 , GLN A:101 , HOH A:215 , HOH A:222 , HOH A:227 , HOH A:239 , HOH A:247binding site for residue MN A 102
03AC3SOFTWAREG A:12 , NA A:107 , HOH A:240 , HOH A:250 , HOH A:258 , HOH A:280 , HOH A:286binding site for residue MN A 103
04AC4SOFTWAREC A:34binding site for residue MG A 105
05AC5SOFTWAREG A:12 , A A:13 , HOH A:225 , HOH A:231 , C B:33binding site for residue NA A 106
06AC6SOFTWAREG A:11 , G A:12 , MN A:103 , HOH A:208 , HOH A:280binding site for residue NA A 107
07AC7SOFTWAREG A:20 , C A:21 , HOH A:241 , HOH A:259 , HOH A:275binding site for residue NA A 108
08AC8SOFTWAREG A:46 , HOH A:204 , HOH A:235 , HOH A:257 , HOH A:284binding site for residue NA A 109
09AC9SOFTWAREG A:31 , U A:32 , HOH A:201 , HOH D:228binding site for residue NA A 110
10AD1SOFTWAREA A:29 , G A:30 , HOH A:274 , HOH A:282binding site for residue NA A 111
11AD2SOFTWAREC B:1 , G B:22 , G B:23 , A B:24 , G B:54 , C B:58 , G B:59 , C B:60 , MN B:103binding site for residue GLN B 101
12AD3SOFTWAREG B:26binding site for residue MN B 102
13AD4SOFTWAREGLN B:101 , HOH B:227 , HOH B:228 , HOH B:230 , HOH B:238 , HOH B:255binding site for residue MN B 103
14AD5SOFTWAREHOH B:224 , HOH B:251binding site for residue MG B 104
15AD6SOFTWAREG B:12 , NA B:106 , HOH B:221 , HOH B:234 , HOH B:249 , HOH B:257 , HOH B:263binding site for residue MG B 105
16AD7SOFTWAREG B:11 , G B:12 , MG B:105 , HOH B:216 , HOH B:245 , HOH B:249 , HOH B:257 , HOH B:261binding site for residue NA B 106
17AD8SOFTWAREG B:31 , U B:32 , C B:33 , G B:46 , G B:47 , HOH B:201 , HOH B:248binding site for residue NA B 107
18AD9SOFTWAREG B:30 , G B:31 , U B:32 , HOH B:241 , HOH B:243binding site for residue NA B 108
19AE1SOFTWAREA B:29 , G B:30 , HOH B:205 , HOH B:259binding site for residue NA B 109
20AE2SOFTWAREHOH A:246 , U B:42 , ASP C:91 , HOH C:216binding site for residue NA B 110
21AE3SOFTWAREU A:42 , HOH A:265 , HOH A:283 , A B:52 , HOH B:203 , HOH B:225 , ASP D:91 , HOH D:201binding site for residue NA D 101

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5DDQ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5DDQ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5DDQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5DDQ)

(-) Exons   (0, 0)

(no "Exon" information available for 5DDQ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:RNA  Length:61
                                                                                            
                  5ddq A  1 CGUUGACCCAGGAAACUGGGCGGAAGUAAGGUCCAUUGCACUCCGGGCCUGAAGCAACGCG 61
                                    10        20        30        40        50        60 

Chain B from PDB  Type:RNA  Length:61
                                                                                            
                  5ddq B  1 CGUUGACCCAGGAAACUGGGCGGAAGUAAGGUCCAUUGCACUCCGGGCCUGAAGCAACGCG 61
                                    10        20        30        40        50        60 

Chain C from PDB  Type:PROTEIN  Length:94
                                                                                                                             
               SCOP domains ---------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeee......hhhhhhhhhhhhhhhhh.eeeeee.........eeeee.hhhhhhhhhhhhh..ee..ee.eeee....hhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------- Transcript
                  5ddq C  3 PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM 96
                                    12        22        32        42        52        62        72        82        92    

Chain D from PDB  Type:PROTEIN  Length:93
                                                                                                                            
               SCOP domains --------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeee......hhhhhhhhhhhhhhhhh.eeeeee.........eeeee.hhhhhhhhhhhhh..ee..ee.eeee......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------- Transcript
                  5ddq D  2 VPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIA 94
                                    11        21        31        41        51        61        71        81        91   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5DDQ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5DDQ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5DDQ)

(-) Gene Ontology  (17, 17)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GLN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ddq)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ddq
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SNRPA_HUMAN | P09012
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  SNRPA_HUMAN | P09012
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SNRPA_HUMAN | P090121aud 1drz 1dz5 1fht 1m5k 1m5o 1m5p 1m5v 1nu4 1oia 1sj3 1sj4 1sjf 1u6b 1urn 1vbx 1vby 1vbz 1vc0 1vc5 1vc6 1zzn 2a3j 2nz4 2oih 2oj3 2u1a 3bo2 3bo3 3bo4 3cul 3cun 3egz 3g8s 3g8t 3g96 3g9c 3hhn 3iin 3irw 3iwn 3k0j 3l3c 3mum 3mur 3mut 3muv 3mxh 3p49 3pgw 3r1h 3r1l 3ucu 3ucz 3ud3 3ud4 3utr 4c4w 4pr6 4prf 4w90 4w92 4yb1 5ddo 5ddp 5ddr 5fj4

(-) Related Entries Specified in the PDB File

5ddo 5ddp 5ddr