Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  MGLUR3 COMPLEXED WITH GLUTAMATE ANALOG
 
Authors :  J. A. Monn, D. K. Clawson, D. Mckinzie
Date :  17 Jul 15  (Deposition) - 09 Sep 15  (Release) - 07 Oct 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.84
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Biol. Unit 2:  A  (1x)
Keywords :  Glutamate Receptor, Ligand, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. A. Monn, L. Prieto, L. Taboada, J. Hao, M. R. Reinhard, S. S. Henry, C. D. Beadle, L. Walton, T. Man, H. Rudyk, B. Clark, D. Tupper, S. R. Baker, C. Lamas, C. Montero, A. Marcos, J. Blanco, M. Bures, D. K. Clawson, S. Atwell, F. Lu, J. Wang, M. Russell, B. A. Heinz, X. Wang J. H. Carter, B. G. Getman, J. T. Catlow, S. Swanson, B. G. Johnson, D. B. Shaw, D. L. Mckinzie
Synthesis And Pharmacological Characterization Of C4-(Thiotriazolyl) -Substituted-2-Aminobicyclo[3. 1. 0]Hexane-2, 6-Dicarboxylates Identification Of (1R, 2S, 4R, 5R, 6R)-2-Amino-4-(1H-1, 2, 4-Triazol-3-Ylsulfanyl) Bicyclo[3. 1. 0]Hexane-2, 6-Dicarboxylic Acid (Ly2812223), A Highly Potent, Functionally Selective Mglu2 Receptor Agonist.
J. Med. Chem. V. 58 7526 2015
PubMed-ID: 26313429  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.5B01124

(-) Compounds

Molecule 1 - METABOTROPIC GLUTAMATE RECEPTOR 3
    Chains: A
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Common: FALL ARMYWORM
    Expression System Taxid: 7108
    Expression System Vector Type: BACULOVIRUS
    Fragment: UNP RESIDUES 2-507
    Gene: GRM3, GPRC1C, MGLUR3
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: MGLUR3

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A
Biological Unit 2 (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 5)

Asymmetric Unit (4, 5)
No.NameCountTypeFull Name
152Q1Ligand/Ion(1R,2S,4R,5R,6R)-2-AMINO-4-(1H-1,2,4-TRIAZOL-3-YLSULFANYL)BICYCLO[3.1.0]HEXANE-2,6-DICARBOXYLIC ACID
2CL2Ligand/IonCHLORIDE ION
3MG1Ligand/IonMAGNESIUM ION
4SO41Ligand/IonSULFATE ION
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
152Q2Ligand/Ion(1R,2S,4R,5R,6R)-2-AMINO-4-(1H-1,2,4-TRIAZOL-3-YLSULFANYL)BICYCLO[3.1.0]HEXANE-2,6-DICARBOXYLIC ACID
2CL-1Ligand/IonCHLORIDE ION
3MG-1Ligand/IonMAGNESIUM ION
4SO42Ligand/IonSULFATE ION
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
152Q1Ligand/Ion(1R,2S,4R,5R,6R)-2-AMINO-4-(1H-1,2,4-TRIAZOL-3-YLSULFANYL)BICYCLO[3.1.0]HEXANE-2,6-DICARBOXYLIC ACID
2CL-1Ligand/IonCHLORIDE ION
3MG-1Ligand/IonMAGNESIUM ION
4SO41Ligand/IonSULFATE ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:64 , ARG A:68 , TYR A:150 , SER A:151 , ALA A:172 , SER A:173 , THR A:174 , LYS A:389 , HOH A:716 , HOH A:735binding site for residue 52Q A 601
2AC2SOFTWARETHR A:98 , SER A:149 , TYR A:150 , VAL A:153binding site for residue CL A 602
3AC3SOFTWAREARG A:101 , ASP A:102 , THR A:103binding site for residue SO4 A 604
4AC4SOFTWAREILE A:79 , ASP A:82 , LEU A:85 , LEU A:86 , HOH A:709 , HOH A:754binding site for residue MG A 605

(-) SS Bonds  (3, 3)

Asymmetric Unit
No.Residues
1A:57 -A:99
2A:361 -A:373
3A:412 -A:419

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Gly A:147 -Gly A:148

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5CNM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5CNM)

(-) Exons   (0, 0)

(no "Exon" information available for 5CNM)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:434
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee...eeeeeee..eee......eeee....hhhhhhhhhhhhhhhh..........eeeeeee...hhhhhhhhhhhhhhhhh....eeeee...hhhhhhhhhhhhhhh...eee....hhhhhh......eee.....hhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhhhhhhhh..eeeeeeee..hhhhhhhhhhhhh.....eeeee.hhhhhhhhhhhhhhh....eeee......hhhhhh.hhhhhh..eeeee....hhhhhhhhhh..........hhhhhhhhhhh.........................hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhh.hhhhhhhhhhhhh.ee.......hhh.ee...........eeeee....eeeeee...eee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5cnm A  30 RREIKIEGDLVLGGLFPINEKGTGTEECGRINEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNISIATAEKVGIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVASDGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQCSLQNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCDAMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQSYLKVGHWAETLSLDVN 495
                                    39        49        59        69        79        89        99       109       139       149       159       169       179       189       199       209       219       229       239       252       262       272       282       292       302       312       322       332       342       352       362 ||    375       385       395       405       415       425       435       445       455       465      |481       491    
                                                                                                                 117|                                                                                                           248|                                                                                                             364|                                                                                                     472|                
                                                                                                                  138                                                                                                            252                                                                                                              368                                                                                                      479
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5CNM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5CNM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5CNM)

(-) Gene Ontology  (21, 21)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    52Q  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:147 - Gly A:148   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5cnm
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GRM3_HUMAN | Q14832
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GRM3_HUMAN | Q14832
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GRM3_HUMAN | Q14832: 1s8m 3sm9 4xar 5cnk

(-) Related Entries Specified in the PDB File

5cni 5cnj 5cnk