Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL BASIS OF TEMPLATE BOUNDARY DEFINITION IN TETRAHYMENA TELOMERASE
 
Authors :  L. I. Jansson, B. M. Akiyama, A. Ooms, C. Lu, S. M. Rubin, M. D. Stone
Date :  26 Jun 15  (Deposition) - 14 Oct 15  (Release) - 02 Dec 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym. Unit :  A,B,C,D,E,G
Biol. Unit 1:  A,C,D  (1x)
Biol. Unit 2:  B,E,G  (1x)
Keywords :  Telomerase, Rna-Protein Complex, Rna Binding Protein-Rna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. I. Jansson, B. M. Akiyama, A. Ooms, C. Lu, S. M. Rubin, M. D. Stone
Structural Basis Of Template-Boundary Definition In Tetrahymena Telomerase.
Nat. Struct. Mol. Biol. V. 22 883 2015
PubMed-ID: 26436828  |  Reference-DOI: 10.1038/NSMB.3101

(-) Compounds

Molecule 1 - TELOMERASE REVERSE TRANSCRIPTASE
    Chains: A, B
    EC Number: 2.7.7.49
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: TERT
    Organism Scientific: TETRAHYMENA THERMOPHILA
    Organism Taxid: 5911
    Synonym: TELOMERASE CATALYTIC SUBUNIT,TELOMERASE SUBUNIT P133
 
Molecule 2 - RNA (5'-R(P*AP*GP*AP*AP*CP*UP*GP*UP*CP*A)-3')
    Chains: D, E
    Engineered: YES
    Organism Scientific: TETRAHYMENA THERMOPHILA
    Organism Taxid: 5911
    Synthetic: YES
 
Molecule 3 - RNA (5'-R(P*UP*CP*AP*UP*UP*CP*AP*GP*UP*UP*CP*U)-3')
    Chains: C, G
    Engineered: YES
    Mutation: YES
    Organism Scientific: TETRAHYMENA THERMOPHILA
    Organism Taxid: 5911
    Synthetic: YES

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEG
Biological Unit 1 (1x): A CD  
Biological Unit 2 (1x):  B  EG

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1MG2Ligand/IonMAGNESIUM ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1MG-1Ligand/IonMAGNESIUM ION
Biological Unit 2 (0, 0)
No.NameCountTypeFull Name
1MG-1Ligand/IonMAGNESIUM ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREG C:8 , HOH C:201 , HOH C:202binding site for residue MG C 101
2AC2SOFTWAREHOH G:201binding site for residue MG G 101

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5C9H)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5C9H)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5C9H)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5C9H)

(-) Exons   (0, 0)

(no "Exon" information available for 5C9H)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:245
                                                                                                                                                                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................................hhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.....hhhhhhhhhhh....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeeee.......eeeeehhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5c9h A 218 QYIYPEIQRSQIFYCNHMGREPGVFKSSFFNYYQSKNFSCQEERDLFLEFTEKIVQNFHNINFNYLLKKFCKLPENYQSLKSQVKQIVKANQQSCENLFNSLYDTEISYKQITNFLRQIIQNCVPNQLLGKKNFKVFLEKLYEFVQMKRFENQKVLDYICFMDVFDVEWFVDLKNQKFTQKRKYISDKRKILGDLIVFIINKIVIPVLRYNFYITEKHKEGSQIFYYRKPIWKLVSKLTIVKLEE 509
                                   227       237       247 ||    300       310       320       330       340       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504     
                                                         249|                                                    348|                                                                                                                                                            
                                                          293                                                     353                                                                                                                                                            


Chain B from PDB  Type:PROTEIN  Length:225
                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhh..............................hhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.....hhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh........h.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeeee.....eeeeehhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5c9h B 218 QYIYPEIQRSQIFYCNHMGREPGVFKSSFFNYLKEYQSKNFSCQEERDLFLEFTEKIVQNFHNINFNYLLKKFCKLPENYQSLKSQVKNLFNSLYDTEISYKQITNFLRQIIQNCVPNQLLGKKNFKVFLEKLYEFVQMKRFENQKVLDYICFMDVFDVEWFVDLKNQKRKYISDKRKILGDLIVFIINKIVIPVLRYNFYITEKEGSQIFYYRKPIWKLVSKLT 503
                                   227       237       247 ||    297       307       317       327       337       362       372       382       392       402       412       422       432       446       456       466       476    || 488       498     
                                                         249|                                                    345|                                                                            440|                                 481|                   
                                                          290                                                     361                                                                             445                                  484                   


Chain C from PDB  Type:RNA  Length:12
                                            
                 5c9h C   1 UCAUUCAGUUCU  12
                                    10  


Chain D from PDB  Type:DNA/RNA  Length:10
                                          
                 5c9h D   1 AGAACUGUCA  10
                                    10


Chain E from PDB  Type:RNA  Length:10
                                          
                 5c9h E  -1 GAACUGUCAU   8
                                     8


Chain G from PDB  Type:RNA  Length:11
                                           
                 5c9h G  -3 CAUUCAGUUCU   7
                                     6
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5C9H)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5C9H)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5C9H)

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5c9h)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5c9h
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TERT_TETTH | O77448
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.49
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TERT_TETTH | O77448
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TERT_TETTH | O77448: 2b2a 2r4g

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5C9H)