Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE GA-SUBSTITUTED FERREDOXIN
 
Authors :  G. Kurisu, N. Muraki, M. Taya, T. Hase
Date :  24 Apr 15  (Deposition) - 23 Sep 15  (Release) - 14 Oct 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.62
Chains :  Asym./Biol. Unit :  A
Keywords :  Analogue, Electron Transfer Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Mutoh, N. Muraki, K. Shinmura, H. Kubota-Kawai, Y. H. Lee, M. M. Nowaczyk, M. Rogner, T. Hase, T. Ikegami, G. Kurisu
X-Ray Structure And Nuclear Magnetic Resonance Analysis Of The Interaction Sites Of The Ga-Substituted Cyanobacterial Ferredoxin
Biochemistry V. 54 6052 2015
PubMed-ID: 26348494  |  Reference-DOI: 10.1021/ACS.BIOCHEM.5B00601

(-) Compounds

Molecule 1 - FERREDOXIN-1
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GenePETF, FED
    Organism ScientificSYNECHOCYSTIS SP. (STRAIN PCC 6803 / KAZUSA)
    Organism Taxid1111708
    StrainPCC 6803 / KAZUSA
    SynonymFERREDOXIN I

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 9)

Asymmetric/Biological Unit (3, 9)
No.NameCountTypeFull Name
1BEN6Ligand/IonBENZAMIDINE
2GAK1Ligand/Ion[2GA-2S] CLUSTER
3SO42Ligand/IonSULFATE ION

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:38 , CYS A:39 , ARG A:40 , GLY A:42 , ALA A:43 , CYS A:44 , CYS A:47 , CYS A:77binding site for residue GAK A 101
2AC2SOFTWARELYS A:50 , THR A:52 , GLU A:93 , HOH A:203binding site for residue SO4 A 102
3AC3SOFTWARESER A:15 , ILE A:16 , GLU A:17 , ALA A:31 , BEN A:108 , HOH A:213binding site for residue SO4 A 103
4AC4SOFTWAREASP A:11 , PHE A:63 , ASP A:65 , GLN A:68 , BEN A:105 , BEN A:106binding site for residue BEN A 104
5AC5SOFTWAREGLY A:32 , LEU A:33 , PHE A:63 , ASP A:65 , BEN A:104 , BEN A:108binding site for residue BEN A 105
6AC6SOFTWAREPRO A:10 , ASP A:11 , GLY A:12 , ASP A:65 , TYR A:96 , BEN A:104binding site for residue BEN A 106
7AC7SOFTWAREILE A:51 , THR A:52 , ALA A:53 , GLY A:54 , GLU A:70 , GLY A:72 , HOH A:203 , HOH A:225binding site for residue BEN A 107
8AC8SOFTWARESER A:14 , SER A:15 , ILE A:16 , ALA A:31 , LEU A:33 , GLN A:61 , SER A:62 , PHE A:63 , LEU A:64 , SO4 A:103 , BEN A:105binding site for residue BEN A 108
9AC9SOFTWAREASP A:11 , SER A:38binding site for residue BEN A 109

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5AUK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5AUK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5AUK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5AUK)

(-) Exons   (0, 0)

(no "Exon" information available for 5AUK)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:96
                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeee..eeeeeeee...hhhhhhhhhh...............eeeeee..ee.......hhhhhhh.eee.hhhee...eeee..hhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------ Transcript
                  5auk A  1 ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY 96
                                    10        20        30        40        50        60        70        80        90      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5AUK)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5AUK)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5AUK)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BEN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GAK  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5auk)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5auk
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FER_SYNY3 | P27320
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FER_SYNY3 | P27320
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FER_SYNY3 | P273201dox 1doy 1off 2kaj 2pvg 2pvo

(-) Related Entries Specified in the PDB File

5aui