Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  MOLECULAR DYNAMICS FLEXIBLE FITTING MODEL OF COXSACKIEVIRUS A16 EMPTY PROCAPSID VP3 SUBUNIT
 
Authors :  C. Fan, Y. Cong, X. Ye, Z. Huang
Date :  29 Oct 16  (Deposition) - 01 Feb 17  (Release) - 01 Feb 17  (Revision)
Method :  ELECTRON MICROSCOPY
Resolution :  6.50
Chains :  Asym. Unit :  C
Biol. Unit 1:  C  (60x)
Keywords :  Coxsackievirus, Virus (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  F. Chen, X. Ye, Z. I. Ku, L. L. Kong, Q. Liu, C. Xu, Y. Cong, Z. Huang
Structural Alteration And Surface Modifi Cation Of Coxsackievirus A16 Capsids By Beta-Propiolactone Treatment
J. Virol. 2017
PubMed: search

(-) Compounds

Molecule 1 - COXSACKIEVIRUS A16
    Cell Line: VERO
    Chains: C
    Organism Scientific: COXSACKIEVIRUS A16
    Organism Taxid: 31704
    Strain: SZ05

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : C
Biological Unit 1 (60x): C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5TSL)

(-) Sites  (0, 0)

(no "Site" information available for 5TSL)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5TSL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5TSL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5TSL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5TSL)

(-) Exons   (0, 0)

(no "Exon" information available for 5TSL)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain C from PDB  Type:PROTEIN  Length:229
                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........................................hhhhhhh..ee...........hhhhh.eeeee.......eeeeee......hhhhhhhhhhhhh.eeeeeeeeeeeeee........eeeeeee........hhhhhhhheeeeee.....eeeeeeeee.............eeeeee............eeeeeeeeee....eeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5tsl C   1 GIPTELKPGTNQFLTTDDGVSAPILPGFHPTPPIHIPGEVHNLLEICRVETILEVNNLKTNETTPMQRLCFPVSVQSKTGELCAAFRADPGRDGPWQSTILGQLCRYYTQWSGSLEVTFMFAGSFMATGKMLIAYTPPGGNVPADRITAMLGTHVIWDFGLQSSVTLVVPWISNTHYRADYYTTGIITIWYQTNYVVPIGAPTTAYIVALAAAQDNFTMKLCKDTEDIE 236
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       187       197       207       217       227         
                                                                                                                                                                                                            179|                                                 
                                                                                                                                                                                                             187
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5TSL)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5TSL)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5TSL)

(-) Gene Ontology  (36, 36)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5tsl)
 
  Sites
(no "Sites" information available for 5tsl)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5tsl)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5tsl
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A9LXZ4_9ENTO | A9LXZ4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A9LXZ4_9ENTO | A9LXZ4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A9LXZ4_9ENTO | A9LXZ4: 5tsk

(-) Related Entries Specified in the PDB File

5tsk