Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MULTIDONOR HV6-1-CLASS BROADLY NEUTRALIZING INFLUENZA A ANTIBODY 56.A.09 IN COMPLEX WITH HEMAGGLUTININ HONG KONG 1968.
 
Authors :  M. G. Joyce, P. V. Thomas, A. K. Wheatley, A. B. Mcdermott, J. R. Mascola,
Date :  31 May 16  (Deposition) - 21 Dec 16  (Release) - 21 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.97
Chains :  Asym. Unit :  A,B,F,H,I,L
Biol. Unit 1:  A,B,I  (1x)
Biol. Unit 2:  F,H,L  (1x)
Keywords :  Influenza, Multidonor, H5, Universal Influenza Vaccine, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. G. Joyce, A. K. Wheatley, P. V. Thomas, G. Y. Chuang, C. Soto, R. T. Bailer, A. Druz, I. S. Georgiev, R. A. Gillespie, M. Kanekiyo, W. P. Kong, K. Leung, S. N. Narpala, M. S. Prabhakaran, E. S. Yang, B. Zhang, Y. Zhang, M. Asokan, J. C. Boyington, T. Bylund, S. Darko, C. R. Lees, A. Ransier, C. H. Shen, L. Wang, J. R. Whittle, X. Wu, H. M. Yassine, C. Santos, Y. Matsuoka, Y. Tsybovsky, U. Baxa, J. C. Mullikin, K. Subbarao, D. C. Douek, B. S. Graham, R. A. Koup, J. E. Ledgerwood, M. Roederer, L. Shapiro, P. D. Kwong, J. R. Mascola, A. B. Mcdermott
Vaccine-Induced Antibodies That Neutralize Group 1 And Grou 2 Influenza A Viruses.
Cell V. 166 609 2016
PubMed-ID: 27453470  |  Reference-DOI: 10.1016/J.CELL.2016.06.043

(-) Compounds

Molecule 1 - 56.A.09 HEAVY CHAIN
    Chains: A, H
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Taxid: 9606
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
 
Molecule 2 - 56.A.09 LIGHT CHAIN
    Chains: B, L
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Taxid: 9606
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
 
Molecule 3 - HEMAGGLUTININ
    Chains: I, F
    Engineered: YES
    Expression System: HOMO SAPIENS
    Expression System Taxid: 9606
    Gene: HA
    Organism Scientific: INFLUENZA A VIRUS (STRAIN A/HONG KONG/1/1968 H3N2)
    Organism Taxid: 506350
    Strain: A/HONG KONG/1/1968 H3N2

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABFHIL
Biological Unit 1 (1x): AB  I 
Biological Unit 2 (1x):   FH L

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 48)

Asymmetric Unit (3, 48)
No.NameCountTypeFull Name
1BMA9Ligand/IonBETA-D-MANNOSE
2MAN15Ligand/IonALPHA-D-MANNOSE
3NAG24Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 1 (3, 22)
No.NameCountTypeFull Name
1BMA4Ligand/IonBETA-D-MANNOSE
2MAN6Ligand/IonALPHA-D-MANNOSE
3NAG12Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 2 (3, 26)
No.NameCountTypeFull Name
1BMA5Ligand/IonBETA-D-MANNOSE
2MAN9Ligand/IonALPHA-D-MANNOSE
3NAG12Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP I:7 , ASN I:8binding site for residue NAG I 601
02AC2SOFTWAREPRO F:4 , ASN F:8binding site for Mono-Saccharide NAG F 601 bound to ASN F 8
03AC3SOFTWAREASN F:22 , PRO I:143binding site for Poly-Saccharide residues NAG F 602 through MAN F 606 bound to ASN F 22
04AC4SOFTWARETHR F:24 , ASN F:38 , ALA F:39 , GLN H:1 , VAL H:2 , GLY H:26 , ARG H:33 , MET H:98 , ILE H:99 , PHE H:100 , GLY H:100Abinding site for Poly-Saccharide residues NAG F 607 through MAN F 612 bound to ASN F 38
05AC5SOFTWAREASN F:81 , ARG F:150binding site for Poly-Saccharide residues NAG F 613 through BMA F 615 bound to ASN F 81
06AC6SOFTWARELYS B:169 , ASN F:165 , THR F:167binding site for Mono-Saccharide NAG F 621 bound to ASN F 165
07AC7SOFTWARESER F:45 , ASN F:285 , VAL F:297 , ASP I:275binding site for Poly-Saccharide residues NAG F 622 through MAN F 626 bound to ASN F 285
08AC8SOFTWAREALA F:476 , ASN F:483 , GLN L:27binding site for Poly-Saccharide residues NAG F 616 through MAN F 620 bound to ASN F 483
09AC9SOFTWAREASN I:22binding site for Mono-Saccharide NAG I 602 bound to ASN I 22
10AD1SOFTWAREGLY A:26 , ASP A:27 , ARG A:33 , MET A:98 , ILE A:99 , PHE A:100 , GLY A:100A , THR B:56 , THR I:24 , ASN I:38binding site for Poly-Saccharide residues NAG I 603 through MAN I 607 bound to ASN I 38
11AD2SOFTWAREASN I:81 , PHE I:120 , ILE I:121 , THR I:122binding site for Poly-Saccharide residues NAG I 608 through BMA I 610 bound to ASN I 81
12AD3SOFTWAREASN I:165binding site for Poly-Saccharide residues NAG I 611 through NAG I 612 bound to ASN I 165
13AD4SOFTWARESER I:91 , PHE I:94 , SER I:270 , ASN I:285binding site for Poly-Saccharide residues NAG I 613 through MAN I 617 bound to ASN I 285
14AD5SOFTWAREGLN B:27 , ALA I:476 , GLU I:479 , ASN I:483binding site for Poly-Saccharide residues NAG I 618 through MAN I 622 bound to ASN I 483

(-) SS Bonds  (22, 22)

Asymmetric Unit
No.Residues
1A:22 -A:92
2A:140 -A:196
3A:216 -B:214
4B:23 -B:88
5B:134 -B:194
6F:14 -F:466
7F:52 -F:277
8F:64 -F:76
9F:97 -F:139
10F:281 -F:305
11F:473 -F:477
12H:22 -H:92
13H:140 -H:196
14H:216 -L:214
15I:14 -I:466
16I:52 -I:277
17I:64 -I:76
18I:97 -I:139
19I:281 -I:305
20I:473 -I:477
21L:23 -L:88
22L:134 -L:194

(-) Cis Peptide Bonds  (11, 11)

Asymmetric Unit
No.Residues
1Phe A:146 -Pro A:147
2Glu A:148 -Pro A:149
3Ser B:7 -Pro B:8
4Tyr B:140 -Pro B:141
5Asn I:54 -Pro I:55
6Phe H:146 -Pro H:147
7Glu H:148 -Pro H:149
8Ser L:7 -Pro L:8
9Tyr L:140 -Pro L:141
10Asn F:54 -Pro F:55
11Thr F:128 -Gly F:129

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5K9K)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5K9K)

(-) Exons   (0, 0)

(no "Exon" information available for 5K9K)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:226
                                                                                                                                                                                                                                                                   
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...eee....eeeeeeeee.........eeeeeeee...eeeeeeeeee...eeeee.hhhh..eeeeee....eeeeeee..hhhhheeeeeeeeeeee..eeeeeeee...eeeee........eeeee.......eeeeeeeeeee.....eeee........eee...ee.....eeeeeeeeee.hhh....eeeeeeehhhheeeeeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5k9k A    1 QVQLQQSGPGLVKPSQTLSLTCVISGDTVSSNRAAWNWIRQSPSRGLEWLGRTYYRSKWYTDYAVSVKSRITITPDTSKNQFSLQMKSVTPEDTAVYYCARGSAMIFGIVIILESWGQGTLVTVSSASTKGPSVFPLAPSSKSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC  216
                                    10        20        30     || 38        48    ||  56        66        76      ||83        93      100C|||    107       117       127  ||   140       150       160       170       180       190       200       210      
                                                             35A|               52A|                            82A||               100A|||||                           130|                                                                                  
                                                              35B                52B                             82B|                100B||||                            134                                                                                  
                                                                                                                  82C                 100C|||                                                                                                                 
                                                                                                                                       100D||                                                                                                                 
                                                                                                                                        100E|                                                                                                                 
                                                                                                                                         100F                                                                                                                 


Chain B from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                        
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeee.....eeeeeeeeeeehhh.eeeeee......eeeee...ee.......eeeeeeeeeeeeee...hhhhheeeeeeee....eee...eeeee.......eeeee..hhhhhh..eeeeeeeeeee.....eeeeee........eeeee.........eeeeeeeeeehhhhhhh.eeeeeee.......eeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5k9k B    1 EIVLTQSPGTLSLSPGERATLSCRASQSVASSYLAWYQQKPGQAPRLLIYGASSRATGVPDRFSGSGSGTDFILTISRLEPEDFAVYYCQQYDGSQYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC  214
                                    10        20       |29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209     
                                                     27A                                                                                                                                                                                           


Chain F from PDB  Type:PROTEIN  Length:497
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeee......eee.......eee..eee.ee......eeee...ee.....hhhhhhhhhhhhh........eeee..........ee..hhhhhhhhhhhh....eee.............hhhhh..........eee............eeee......eeeeeeeee..hhhhhhhhhh....eeeee....eeee...............eeeeeeeee....eeeeeeee.eeee.eeee......eeee....eeeee..eee..eee.....ee...........ee......eee...........hhhhh................eeeeee.....eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee....eeee....hhhhhhhhhhh..hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5k9k F    4 PGNDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIESRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQRGLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQ  501
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323   ||  334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       
                                                                                                                                                                                                                                                                                                                                                             327|                                                                                                                                                                            
                                                                                                                                                                                                                                                                                                                                                              329                                                                                                                                                                            


Chain H from PDB  Type:PROTEIN  Length:224
                                                                                                                                                                                                                                                                 
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...eee.....eeeeeeee.........eeeeeeee...eeeeeeeeee...eeeee...hhh.eeeeee....eeeeee...hhhhheeeeeeeeeeee..eeeeeeee...eeeee........eeeee.....eeeeeeeeeee.....eeee.hhh.....ee...ee.....eeeeeeeeee.hhh....eeeeeee....eeeeeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5k9k H    1 QVQLQQSGPGLVKPSQTLSLTCVISGDTVSSNRAAWNWIRQSPSRGLEWLGRTYYRSKWYTDYAVSVKSRITITPDTSKNQFSLQMKSVTPEDTAVYYCARGSAMIFGIVIILESWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC  216
                                    10        20        30     || 38        48    ||  56        66        76      ||83        93      100C|||    107       117       127||     142       152       162       172       182       192       202       212    
                                                             35A|               52A|                            82A||               100A|||||                         128|                                                                                  
                                                              35B                52B                             82B|                100B||||                          134                                                                                  
                                                                                                                  82C                 100C|||                                                                                                               
                                                                                                                                       100D||                                                                                                               
                                                                                                                                        100E|                                                                                                               
                                                                                                                                         100F                                                                                                               


Chain I from PDB  Type:PROTEIN  Length:490
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee......eee.......eee..eee.ee......eeee...eeee...hhhhhhhhhhhhhhhh.....eeee..........ee..hhhhhhhhhhhh....eee.......ee....eeeeee..eee....eee.ee.......eeeeee.....eeeeeeeeee..hhhhhhhhhh....eeeeee..eeeee...............eeeeeeeee....eeeeeeee.eeee.eeeee.....eeee....eeeee..eee..eee.....ee...........ee......eee...........................eeeeee....eeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee....eeee....hhhhhhhhhh...hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5k9k I    6 NDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIESRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQTIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQ  501
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325  ||   341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501
                                                                                                                                                                                                                                                                                                                                                            328|                                                                                                                                                                      
                                                                                                                                                                                                                                                                                                                                                             335                                                                                                                                                                      


Chain L from PDB  Type:PROTEIN  Length:215
                                                                                                                                                                                                                                                        
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeee.....eeeeeeeeeeehhh.eeeeee......eeeee...ee.......eeeeeeeeeeeeee...hhhhheeeeeeee....ee....eeeee.......eeeee..hhhhhhh.eeeeeeeee.......eeeeee..ee....eeeee..........eeeeeeeeehhhhh...eeeeeee.......eeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5k9k L    1 EIVLTQSPGTLSLSPGERATLSCRASQSVASSYLAWYQQKPGQAPRLLIYGASSRATGVPDRFSGSGSGTDFILTISRLEPEDFAVYYCQQYDGSQYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC  214
                                    10        20       |29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209     
                                                     27A
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5K9K)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5K9K)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5K9K)

(-) Gene Ontology  (17, 17)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn F:54 - Pro F:55   [ RasMol ]  
    Asn I:54 - Pro I:55   [ RasMol ]  
    Glu A:148 - Pro A:149   [ RasMol ]  
    Glu H:148 - Pro H:149   [ RasMol ]  
    Phe A:146 - Pro A:147   [ RasMol ]  
    Phe H:146 - Pro H:147   [ RasMol ]  
    Ser B:7 - Pro B:8   [ RasMol ]  
    Ser L:7 - Pro L:8   [ RasMol ]  
    Thr F:128 - Gly F:129   [ RasMol ]  
    Tyr B:140 - Pro B:141   [ RasMol ]  
    Tyr L:140 - Pro L:141   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5k9k
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HEMA_I68A4 | Q91MA7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HEMA_I68A4 | Q91MA7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HEMA_I68A4 | Q91MA7: 3sdy 3ztj 4fnk 4fp8 4fqr 4fqy 4nm8 4ubd 4we4 4zcj 5k9q 5kan 5kuy 5t6n 5thf 5umn 5vtq 5vtr 5vtu 5vtv 5vtw 5vtx 5vty 5vtz 5vu4

(-) Related Entries Specified in the PDB File

5k9o 5kaq