Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HUMAN GAR TRANSFORMYLASE IN COMPLEX WITH GAR AND (4-{[2-(2-AMINO-4-OXO-4,7-DIHYDRO-3H-PYRROLO[2,3-D]PYRIMIDIN-6-YL)ETHYL]AMINO}BENZOYL)-L-GLUTAMIC ACID (AGF183)
 
Authors :  J. Wong, S. M. Deis, C. E. Dann Iii
Date :  09 Apr 16  (Deposition) - 10 Aug 16  (Release) - 21 Sep 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (1x)
Keywords :  Gar Transformylase, Antifolate, Ligase-Ligase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. K. Golani, A. Wallace-Povirk, S. M. Deis, J. Wong, J. Ke, X. Gu, S. Raghavan, M. R. Wilson, X. Li, L. Polin, P. W. De Waal, K. White, J. Kushner, C. O'Connor, Z. Hou, H. E. Xu, K. Melcher, C. E. Dann, L. H. Matherly, A. Gangjee
Tumor Targeting With Novel 6-Substituted Pyrrolo [2, 3-D] Pyrimidine Antifolates With Heteroatom Bridge Substitutions Via Cellular Uptake By Folate Receptor Alpha And The Proton-Coupled Folate Transporter And Inhibition Of De Novo Purine Nucleotide Biosynthesis.
J. Med. Chem. V. 59 7856 2016
PubMed-ID: 27458733  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.6B00594

(-) Compounds

Molecule 1 - TRIFUNCTIONAL PURINE BIOSYNTHETIC PROTEIN ADENOSINE-3
    Chains: A
    EC Number: 6.3.4.13, 6.3.3.1, 2.1.2.2
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET22B
    Expression System Strain: ROSETTA(DE3)PLYSS
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 808-1010
    Gene: GART, PGFT, PRGS
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (1x): A
Biological Unit 2 (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric Unit (2, 2)
No.NameCountTypeFull Name
183A1Ligand/IonN-(4-{[2-(2-AMINO-4-OXO-4,7-DIHYDRO-3H-PYRROLO[2,3-D]PYRIMIDIN-6-YL)ETHYL]AMINO}BENZENE-1-CARBONYL)-L-GLUTAMIC ACID
2GAR1Ligand/IonGLYCINAMIDE RIBONUCLEOTIDE
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
183A1Ligand/IonN-(4-{[2-(2-AMINO-4-OXO-4,7-DIHYDRO-3H-PYRROLO[2,3-D]PYRIMIDIN-6-YL)ETHYL]AMINO}BENZENE-1-CARBONYL)-L-GLUTAMIC ACID
2GAR1Ligand/IonGLYCINAMIDE RIBONUCLEOTIDE
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
183A1Ligand/IonN-(4-{[2-(2-AMINO-4-OXO-4,7-DIHYDRO-3H-PYRROLO[2,3-D]PYRIMIDIN-6-YL)ETHYL]AMINO}BENZENE-1-CARBONYL)-L-GLUTAMIC ACID
2GAR1Ligand/IonGLYCINAMIDE RIBONUCLEOTIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR A:817 , GLY A:818 , SER A:819 , ASN A:820 , GLY A:894 , PRO A:916 , LYS A:977 , GLU A:980 , 83A A:1102 , HOH A:1201 , HOH A:1207 , HOH A:1208 , HOH A:1209 , HOH A:1211 , HOH A:1234binding site for residue GAR A 1101
2AC2SOFTWAREPHE A:895 , MET A:896 , ARG A:897 , ILE A:898 , LEU A:899 , VAL A:904 , ASN A:913 , HIS A:944 , VAL A:946 , ALA A:947 , GLU A:948 , VAL A:950 , ASP A:951 , GAR A:1101 , HOH A:1201 , HOH A:1205binding site for residue 83A A 1102

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5J9F)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Leu A:919 -Pro A:920

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5J9F)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5J9F)

(-) Exons   (0, 0)

(no "Exon" information available for 5J9F)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:200
                                                                                                                                                                                                                                         
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhh......eeeeeee....hhhhhhhhhh...eee.hhhhh.hhhhhhhhhhhhhhhh...eeee.......hhhhhhhh...eeeee..........hhhhhhhhhh..eeeeeeee.........eeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh..eee.....eee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5j9f A  808 ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVAKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV 1007
                                   817       827       837       847       857       867       877       887       897       907       917       927       937       947       957       967       977       987       997      1007
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5J9F)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5J9F)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5J9F)

(-) Gene Ontology  (27, 27)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    83A  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GAR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:919 - Pro A:920   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5j9f
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PUR2_HUMAN | P22102
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.2.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  6.3.3.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  6.3.4.13
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PUR2_HUMAN | P22102
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PUR2_HUMAN | P22102: 1mej 1men 1meo 1njs 1rbm 1rbq 1rby 1rbz 1rc0 1rc1 1zlx 1zly 2qk4 2v9y 4ew1 4ew2 4ew3 4zyt 4zyu 4zyv 4zyw 4zyx 4zyy 4zyz 4zz0 4zz1 4zz2 4zz3

(-) Related Entries Specified in the PDB File

5izq