Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  2-METHYL-3-HYDROXYPYRIDINE-5-CARBOXYLIC ACID OXYGENASE, 5HN BOUND
 
Authors :  J. Kobayashi, B. Mikami
Date :  30 Jan 16  (Deposition) - 12 Oct 16  (Release) - 08 Feb 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (4x)
Keywords :  Alpha/Beta Fold, Flavoenzyme, Substrate Complex, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Kobayashi, H. Yoshida, T. Yagi, S. Kamitori, H. Hayashi, K. Mizutani, N. Takahashi, B. Mikami
Role Of The Tyr270 Residue In 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase From Mesorhizobium Loti
J. Biosci. Bioeng. V. 123 154 2017
PubMed-ID: 27568368  |  Reference-DOI: 10.1016/J.JBIOSC.2016.07.022

(-) Compounds

Molecule 1 - 2-METHYL-3-HYDROXYPYRIDINE-5-CARBOXYLIC ACID OXYGENASE
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET21A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Gene: MLR6788
    Organism Scientific: RHIZOBIUM LOTI (STRAIN MAFF303099)
    Organism Taxid: 266835
    Strain: MAFF303099

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (4x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 10)

Asymmetric Unit (6, 10)
No.NameCountTypeFull Name
15HN1Ligand/Ion5-HYDROXYPYRIDINE-3-CARBOXYLIC ACID
2BME1Ligand/IonBETA-MERCAPTOETHANOL
3FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
4GOL4Ligand/IonGLYCEROL
5NA2Ligand/IonSODIUM ION
6PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
Biological Unit 1 (5, 32)
No.NameCountTypeFull Name
15HN4Ligand/Ion5-HYDROXYPYRIDINE-3-CARBOXYLIC ACID
2BME4Ligand/IonBETA-MERCAPTOETHANOL
3FAD4Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE
4GOL16Ligand/IonGLYCEROL
5NA-1Ligand/IonSODIUM ION
6PEG4Ligand/IonDI(HYDROXYETHYL)ETHER

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLY A:18 , GLY A:20 , PHE A:21 , ALA A:22 , HIS A:40 , GLU A:41 , LYS A:42 , SER A:43 , ILE A:53 , TYR A:54 , ARG A:106 , SER A:128 , GLU A:129 , ALA A:130 , ALA A:155 , ASP A:156 , LEU A:179 , ARG A:181 , GLY A:287 , ASP A:288 , PRO A:295 , ALA A:298 , GLY A:300 , ALA A:301 , GLY A:302 , 5HN A:403 , HOH A:506 , HOH A:507 , HOH A:527 , HOH A:546 , HOH A:576 , HOH A:584 , HOH A:604 , HOH A:624 , HOH A:653 , HOH A:669 , HOH A:671 , HOH A:674 , HOH A:696 , HOH A:803binding site for residue FAD A 401
02AC2SOFTWARETYR A:270 , CYS A:294 , HOH A:533 , HOH A:537 , HOH A:539binding site for residue BME A 402
03AC3SOFTWAREARG A:211 , LEU A:213 , TYR A:223 , PRO A:295 , ALA A:296 , LEU A:352 , FAD A:401 , HOH A:502 , HOH A:503 , HOH A:505 , HOH A:506 , HOH A:510binding site for residue 5HN A 403
04AC4SOFTWAREMET A:293 , GLN A:299 , CYS A:339 , SER A:343 , NA A:405 , HOH A:827binding site for residue NA A 404
05AC5SOFTWAREGLN A:299 , CYS A:303 , CYS A:339 , NA A:404binding site for residue NA A 405
06AC6SOFTWAREGLN A:74 , GLY A:75 , SER A:76 , ASN A:97 , GLU A:219 , PRO A:378 , HOH A:560binding site for residue GOL A 406
07AC7SOFTWAREGLU A:364 , ARG A:367 , TYR A:375binding site for residue GOL A 407
08AC8SOFTWAREARG A:47 , LYS A:169 , ASP A:171 , LYS A:274 , ASP A:276 , HOH A:549binding site for residue GOL A 408
09AC9SOFTWAREHIS A:57 , ARG A:61 , LEU A:69 , ASP A:369 , ARG A:372 , SER A:376 , TRP A:377 , HOH A:854binding site for residue GOL A 409
10AD1SOFTWAREASN A:88 , PRO A:207 , GLU A:247 , HOH A:555 , HOH A:559 , HOH A:608 , HOH A:976binding site for residue PEG A 410

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5HXI)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Trp A:206 -Pro A:207
2Val A:238 -Pro A:239

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HXI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HXI)

(-) Exons   (0, 0)

(no "Exon" information available for 5HXI)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:369
                                                                                                                                                                                                                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..hhhhhhhhhhhhhh..eeeee...........eeeeehhhhhhhhhh.hhhhhhh.......eeeee..eeeeeehhhhh.eeeeehhhhhhhhhhhhhhhh.eee....eeeee...eeee....eee..eeee.....hhhhhhhh..eeeeeeeeeeeeeeee.hhhhhh......eeeee.......eeeeee....eeeeeeee............hhhhhhhhh..hhhhhhhhhh.....eeeeeeeee...ee..eee.hhhhhh.hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhee....ee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hxi A  11 TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ 379
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5HXI)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5HXI)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HXI)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5HN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    BME  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Trp A:206 - Pro A:207   [ RasMol ]  
    Val A:238 - Pro A:239   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5hxi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q988D3_RHILO | Q988D3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q988D3_RHILO | Q988D3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q988D3_RHILO | Q988D3: 3alj 3all 3alm 3gmb 3gmc 4gf7 4h2n 4h2p 4h2q 4h2r 4jy2 4jy3

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5HXI)