Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF NADE FROM STREPTOCOCCUS PYOGENES
 
Authors :  W. T. Booth, M. Chruszcz
Date :  27 Jan 16  (Deposition) - 25 Jan 17  (Release) - 12 Jul 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Nad Synthetase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  W. T. Booth, T. L. Morris, D. P. Mysona, M. J. Shah, L. K. Taylor, T. W. Karlin, K. Clary, K. A. Majorek, L. R. Offermann, M. Chruszcz
Streptococcus Pyogenes Quinolinate-Salvage Pathway - Structural And Functional Studies Of Quinolinate Phosphoribosyl Transferase And Nh3 -Dependent Nad(+) Synthetase.
Febs J. 2017
PubMed-ID: 28618168  |  Reference-DOI: 10.1111/FEBS.14136

(-) Compounds

Molecule 1 - NH(3)-DEPENDENT NAD(+) SYNTHETASE
    Chains: A, B
    EC Number: 6.3.1.5
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PJEXPRESS411
    Expression System Taxid: 469008
    Gene: NADE, SPY49_1281C
    Organism Scientific: STREPTOCOCCUS PYOGENES SEROTYPE M49 (STRAIN NZ131)
    Organism Taxid: 471876
    Strain: NZ131

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 15)

Asymmetric/Biological Unit (2, 15)
No.NameCountTypeFull Name
1MG2Ligand/IonMAGNESIUM ION
2SO413Ligand/IonSULFATE ION

(-) Sites  (15, 15)

Asymmetric Unit (15, 15)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:56 , GLY A:58 , GLN A:59 , ASP A:60 , SER A:61 , SO4 A:306 , MG A:308 , HOH A:412 , HOH A:416 , HOH A:461binding site for residue SO4 A 301
02AC2SOFTWAREHIS A:268 , TYR B:41 , LEU B:48binding site for residue SO4 A 302
03AC3SOFTWAREASN A:174 , GLY A:185 , LEU A:190 , HOH A:466 , PRO B:273binding site for residue SO4 A 303
04AC4SOFTWARETYR A:93 , LYS A:146 , ARG A:150binding site for residue SO4 A 304
05AC5SOFTWARELYS A:201 , TYR A:239 , GLN A:240 , ASP A:243binding site for residue SO4 A 305
06AC6SOFTWAREGLY A:58 , GLN A:59 , ASP A:60 , LYS A:197 , SO4 A:301 , HOH A:463binding site for residue SO4 A 306
07AC7SOFTWARESER A:24 , ILE A:25 , GLU A:128binding site for residue SO4 A 307
08AC8SOFTWAREASP A:60 , GLU A:173 , SO4 A:301 , HOH A:412 , HOH A:461 , HOH A:463binding site for residue MG A 308
09AC9SOFTWAREPRO A:273 , ASN B:174 , PHE B:179 , GLY B:185 , LEU B:190 , LYS B:269binding site for residue SO4 B 301
10AD1SOFTWARESER B:56 , GLY B:58 , GLN B:59 , ASP B:60 , SER B:61 , SO4 B:303 , MG B:307 , HOH B:415 , HOH B:428 , HOH B:455binding site for residue SO4 B 302
11AD2SOFTWAREGLN B:59 , ASP B:60 , LYS B:197 , SO4 B:302 , HOH B:464 , HOH B:465binding site for residue SO4 B 303
12AD3SOFTWAREARG B:198 , LYS B:201 , TYR B:239 , GLN B:240 , ASP B:243 , HOH B:443binding site for residue SO4 B 304
13AD4SOFTWARELYS A:265 , PHE B:47 , VAL B:233 , GLY B:236binding site for residue SO4 B 305
14AD5SOFTWAREGLN B:256 , GLU B:260 , HOH B:423binding site for residue SO4 B 306
15AD6SOFTWAREASP B:60 , GLU B:173 , SO4 B:302 , HOH B:415 , HOH B:455 , HOH B:464binding site for residue MG B 307

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5HUH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5HUH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HUH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HUH)

(-) Exons   (0, 0)

(no "Exon" information available for 5HUH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:261
                                                                                                                                                                                                                                                                                                     
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh....eeeee...hhhhhhhhhhhhhhhhhhhhhhh....eeeeee........hhhhhhhhhhhh..eeee..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.eee....hhhhhh....................hhhhhhhhhhhh..hhhhh..hhhhhhh.hhhhhhhhhh....hhhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5huh A   9 MTLQEEIIRQLGVKASIDPQEEIRKTVDFLKAYLRKHSFLKTYVLGISGGQDSTLAGKLAQMAIAELREETSDQAYQFIAVRLPYGVQADEADAQKALAFIAPDQTLTINIKAAVDGQVEALQAAGVEISDFNKGNIKARQRMISQYAIAGQMAGAVIGTDHAAENITGFFTKFGDGGADILPLFRLNKRQGKALLKVLGADAALYELADEVALGVTYQDIDDYLEGKLISKVAQATIEKWWHKGQHKRHLPITIFADFWK 282
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208      |231       241       251       261       271       281 
                                                                                                                                                                                                                                        215|                                                     
                                                                                                                                                                                                                                         229                                                     


Chain B from PDB  Type:PROTEIN  Length:260
                                                                                                                                                                                                                                                                                                    
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh....eeeee...hhhhhhhhhhhhhhhhhhhhhhh....eeeeee........hhhhhhhhhhhh..eeee..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.eee....hhhhhh....................hhhhhhhhhhhh..hhhhh..hhhhhh.hhhhhhhhhh....hhhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5huh B   9 MTLQEEIIRQLGVKASIDPQEEIRKTVDFLKAYLRKHSFLKTYVLGISGGQDSTLAGKLAQMAIAELREETSDQAYQFIAVRLPYGVQADEADAQKALAFIAPDQTLTINIKAAVDGQVEALQAAGVEISDFNKGNIKARQRMISQYAIAGQMAGAVIGTDHAAENITGFFTKFGDGGADILPLFRLNKRQGKALLKVLGADAALYEADEVALGVTYQDIDDYLEGKLISKVAQATIEKWWHKGQHKRHLPITIFADFWK 282
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208      |232       242       252       262       272       282
                                                                                                                                                                                                                                        215|                                                    
                                                                                                                                                                                                                                         230
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5HUH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5HUH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HUH)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5HUH)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5huh)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5huh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A0H3BZ89_S | A0A0H3BZ89
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  6.3.1.5
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A0A0H3BZ89_S | A0A0H3BZ89
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A0A0H3BZ89_S | A0A0H3BZ89: 5huj

(-) Related Entries Specified in the PDB File

5huj 5hul 5huo 5hup