Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE C49A C353A MUTANT FENNA-MATTHEWS-OLSON PROTEIN FROM CHLOROBACULUM TEPIDUM
 
Authors :  X. Lu, M. J. Cuneo, D. A. A. Myles
Date :  25 Dec 15  (Deposition) - 18 May 16  (Release) - 22 Jun 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,C
Biol. Unit 1:  A  (3x)
Biol. Unit 2:  C  (3x)
Keywords :  Fmo, Antenna Complex, Photosynthesis, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Saer, G. S. Orf, X. Lu, H. Zhang, M. J. Cuneo, D. A. Myles, R. E. Blankenship
Perturbation Of Bacteriochlorophyll Molecules In Fenna-Matthews-Olson Protein Complexes Through Mutagenesis Of Cysteine Residues.
Biochim. Biophys. Acta V. 1857 1455 2016
PubMed-ID: 27114180  |  Reference-DOI: 10.1016/J.BBABIO.2016.04.007

(-) Compounds

Molecule 1 - BACTERIOCHLOROPHYLL A PROTEIN
    Chains: A, C
    Mutation: YES
    Organism Scientific: CHLOROBIUM TEPIDUM (STRAIN ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
    Organism Taxid: 194439
    Strain: ATCC 49652 / DSM 12025 / NBRC 103806 / TLS
    Synonym: BCHL A PROTEIN,FENNA-MATTHEWS-OLSON PROTEIN,FMO PROTEIN

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AC
Biological Unit 1 (3x): A 
Biological Unit 2 (3x):  C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 16)

Asymmetric Unit (1, 16)
No.NameCountTypeFull Name
1BCL16Ligand/IonBACTERIOCHLOROPHYLL A
Biological Unit 1 (1, 24)
No.NameCountTypeFull Name
1BCL24Ligand/IonBACTERIOCHLOROPHYLL A
Biological Unit 2 (1, 24)
No.NameCountTypeFull Name
1BCL24Ligand/IonBACTERIOCHLOROPHYLL A

(-) Sites  (16, 16)

Asymmetric Unit (16, 16)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREVAL A:106 , PHE A:109 , HIS A:111 , PHE A:113 , SER A:127 , ALA A:129 , VAL A:130 , VAL A:152 , LEU A:159 , THR A:162 , TRP A:163 , THR A:166 , PHE A:183 , TRP A:184 , TRP A:223 , BCL A:402 , BCL A:406 , BCL A:408 , HOH A:556binding site for residue BCL A 401
02AC2SOFTWAREPRO A:43 , SER A:73 , VAL A:75 , ASN A:80 , LEU A:82 , TYR A:125 , VAL A:130 , VAL A:134 , PRO A:137 , ILE A:138 , TYR A:139 , GLN A:141 , PHE A:183 , TRP A:184 , ILE A:186 , BCL A:401 , BCL A:403 , BCL A:406 , BCL A:407 , HOH A:705binding site for residue BCL A 402
03AC3SOFTWAREALA A:12 , TYR A:16 , ALA A:34 , PRO A:39 , PRO A:40 , ALA A:41 , ALA A:189 , PHE A:258 , SER A:260 , ILE A:265 , HIS A:298 , VAL A:301 , GLY A:302 , ASN A:305 , PHE A:307 , BCL A:402 , BCL A:404 , BCL A:406 , BCL A:407binding site for residue BCL A 403
04AC4SOFTWARETYR A:16 , ILE A:18 , VAL A:30 , ALA A:32 , LEU A:288 , HIS A:290 , PRO A:294 , HIS A:298 , LEU A:313 , TYR A:345 , TRP A:348 , PHE A:360 , BCL A:403 , BCL A:405 , BCL A:407 , HOH A:563binding site for residue BCL A 404
05AC5SOFTWAREVAL A:55 , PHE A:71 , SER A:235 , ARG A:238 , LEU A:242 , PHE A:243 , PRO A:244 , VAL A:254 , PHE A:273 , PRO A:274 , PRO A:291 , BCL A:404 , BCL A:406 , BCL A:407 , HOH A:621binding site for residue BCL A 405
06AC6SOFTWAREILE A:67 , ALA A:69 , ALA A:86 , ILE A:88 , ARG A:96 , ILE A:97 , SER A:98 , GLY A:117 , VAL A:119 , GLN A:144 , HIS A:146 , TRP A:184 , SER A:235 , TRP A:239 , ALA A:252 , GLN A:253 , VAL A:254 , BCL A:401 , BCL A:402 , BCL A:403 , BCL A:405 , BCL A:407binding site for residue BCL A 406
07AC7SOFTWAREALA A:41 , TYR A:139 , ILE A:186 , PRO A:188 , ALA A:189 , ALA A:192 , GLN A:198 , HIS A:297 , HIS A:298 , VAL A:301 , BCL A:402 , BCL A:403 , BCL A:404 , BCL A:405 , BCL A:406 , HOH A:657 , HOH A:658binding site for residue BCL A 407
08AC8SOFTWAREPHE A:123 , TYR A:124 , ARG A:126 , ASP A:161 , THR A:162 , THR A:166 , LYS A:168 , ALA A:169 , SER A:172 , THR A:173 , PHE A:176 , TRP A:179 , ILE A:180 , PHE A:183 , BCL A:401binding site for residue BCL A 408
09AC9SOFTWAREVAL C:106 , PHE C:109 , HIS C:111 , PHE C:113 , SER C:127 , ALA C:129 , VAL C:130 , VAL C:152 , LEU C:159 , THR C:162 , TRP C:163 , THR C:166 , ILE C:180 , BCL C:402 , BCL C:406 , BCL C:408 , HOH C:519binding site for residue BCL C 401
10AD1SOFTWARESER C:73 , VAL C:75 , ASN C:80 , LEU C:82 , ILE C:84 , PHE C:113 , PHE C:115 , TYR C:125 , VAL C:130 , VAL C:134 , PRO C:137 , ILE C:138 , TYR C:139 , GLN C:141 , PHE C:183 , TRP C:184 , ILE C:186 , BCL C:401 , BCL C:403 , BCL C:406 , BCL C:407 , HOH C:706binding site for residue BCL C 402
11AD2SOFTWAREALA C:12 , TYR C:16 , ALA C:34 , PRO C:39 , PRO C:40 , ALA C:41 , ALA C:189 , PHE C:258 , SER C:260 , ILE C:265 , VAL C:267 , HIS C:298 , VAL C:301 , GLY C:302 , ASN C:305 , BCL C:402 , BCL C:404 , BCL C:405 , BCL C:406 , BCL C:407binding site for residue BCL C 403
12AD3SOFTWARETYR C:16 , ILE C:18 , VAL C:30 , ALA C:32 , ALA C:256 , GLY C:257 , LEU C:288 , HIS C:290 , PRO C:294 , HIS C:298 , LEU C:313 , TYR C:345 , TRP C:348 , PHE C:360 , BCL C:403 , BCL C:405 , BCL C:407 , HOH C:581binding site for residue BCL C 404
13AD4SOFTWARELEU C:53 , VAL C:55 , PHE C:71 , SER C:235 , ARG C:238 , LEU C:242 , PHE C:243 , PRO C:244 , VAL C:254 , PHE C:273 , PRO C:274 , PRO C:291 , BCL C:403 , BCL C:404 , BCL C:406 , BCL C:407 , HOH C:595binding site for residue BCL C 405
14AD5SOFTWAREILE C:67 , ILE C:84 , ALA C:86 , ILE C:88 , ARG C:96 , ILE C:97 , SER C:98 , VAL C:119 , GLN C:144 , HIS C:146 , TRP C:184 , SER C:235 , TRP C:239 , ALA C:252 , BCL C:401 , BCL C:402 , BCL C:403 , BCL C:405 , BCL C:407binding site for residue BCL C 406
15AD6SOFTWAREALA C:41 , PHE C:71 , PRO C:188 , ALA C:189 , ALA C:192 , GLN C:198 , HIS C:297 , HIS C:298 , VAL C:301 , BCL C:402 , BCL C:403 , BCL C:404 , BCL C:405 , BCL C:406 , HOH C:613 , HOH C:618binding site for residue BCL C 407
16AD7SOFTWARELEU C:122 , TYR C:124 , TYR C:125 , ARG C:126 , ASP C:161 , THR C:162 , THR C:166 , LYS C:168 , ALA C:169 , SER C:172 , THR C:173 , PHE C:176 , TRP C:179 , ILE C:180 , PHE C:183 , BCL C:401binding site for residue BCL C 408

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5H8Z)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Leu A:45 -Pro A:46
2Ala A:327 -Pro A:328
3Leu C:45 -Pro C:46
4Ala C:327 -Pro C:328

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5H8Z)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5H8Z)

(-) Exons   (0, 0)

(no "Exon" information available for 5H8Z)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:358
                                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeee.......eeeeeeeee..........eeeeeeeeeeeee....eeeeeeeeeeee..eeeeeeeeeeeee....eeeeeeeeeeee..eeeeeeeeeeeeeee...hhhhhh.........eeeeeeeeeeee..hhhhhhhhhhhhhhhhhh.hhhhhhhhhhh..hhhhhhhhh.eee...eeeeeeeee....eeeeeeeeeeeee...hhhhhh.....hhhhh...eeeeeeeeee..eeeeeeeeee...eeeee..eeee...hhhhhhhhhh.......eeeeeeeee.....eeeeee....eee..eeeeehhhhhhhhhhhhh......eeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h8z A   9 VTTAHSDYEIVLEGGSSSWGKVKARAKVNAPPASPLLPADADVKLNVKPLDPAKGFVRISAVFESIVDSTKNKLTIEADIANETKERRISVGEGMVSVGDFSHTFSFEGSVVNLFYYRSDAVRRNVPNPIYMQGRQFHDILMKVPLDNNDLIDTWEGTVKAIGSTGAFNDWIRDFWFIGPAFTALNEGGQRISRIEVNGLNTESGPKGPVGVSRWRFSHGGSGMVDSISRWAELFPSDKLNRPAQVEAGFRSDSQGIEVKVDGEFPGVSVDAGGGLRRILNHPLIPLVHHGMVGKFNNFNVDAQLKVVLPKGYKIRYAAPQYRSQNLEEYRWSGGAYARWVEHVAKGGVGQFEILYAQ 366
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358        


Chain C from PDB  Type:PROTEIN  Length:358
                                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeee.......eeeeeeeee..........eeeeeeeeeeeee....eeeeeeeeeeee..eeeeeeeeeeeee....eeeeeeeeeeee..eeeeeeeeeeeeeee...hhhhhhhh.......eeeeeeeeeeee..hhhhhhhhhhhhhhhhhh.hhhhhhhhhhh..hhhhhhhhh.eee...eeeeeeeee....eeeeeeeeeeeee...hhhhhh.....hhhhh...eeeeeeeeee..eeeeeeeeee...eeeee..eeee...hhhhhhhhh........eeeeeeeee.....eeeeee....eee..eeeeehhhhhhhhhhhhh......eeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h8z C   9 VTTAHSDYEIVLEGGSSSWGKVKARAKVNAPPASPLLPADADVKLNVKPLDPAKGFVRISAVFESIVDSTKNKLTIEADIANETKERRISVGEGMVSVGDFSHTFSFEGSVVNLFYYRSDAVRRNVPNPIYMQGRQFHDILMKVPLDNNDLIDTWEGTVKAIGSTGAFNDWIRDFWFIGPAFTALNEGGQRISRIEVNGLNTESGPKGPVGVSRWRFSHGGSGMVDSISRWAELFPSDKLNRPAQVEAGFRSDSQGIEVKVDGEFPGVSVDAGGGLRRILNHPLIPLVHHGMVGKFNNFNVDAQLKVVLPKGYKIRYAAPQYRSQNLEEYRWSGGAYARWVEHVAKGGVGQFEILYAQ 366
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5H8Z)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5H8Z)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5H8Z)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BCL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:327 - Pro A:328   [ RasMol ]  
    Ala C:327 - Pro C:328   [ RasMol ]  
    Leu A:45 - Pro A:46   [ RasMol ]  
    Leu C:45 - Pro C:46   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5h8z
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BCPA_CHLTE | Q46393
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  BCPA_CHLTE | Q46393
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BCPA_CHLTE | Q46393: 3bsd 3eni

(-) Related Entries Specified in the PDB File

3bsd 3eni