3BSD - JenaLib

Asymmetric Unit (9, 9)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLU A:195 , HOH A:576 , HOH A:577 , HOH A:578	BINDING SITE FOR RESIDUE MG A 374
2	AC2	SOFTWARE	VAL A:106 , PHE A:109 , HIS A:111 , ALA A:129 , VAL A:130 , VAL A:152 , LEU A:159 , THR A:162 , TRP A:163 , TRP A:184 , SER A:221 , BCL A:368	BINDING SITE FOR RESIDUE BCL A 367
3	AC3	SOFTWARE	SER A:73 , VAL A:75 , ASN A:80 , LEU A:82 , ILE A:84 , PHE A:113 , TYR A:125 , VAL A:130 , VAL A:134 , PRO A:137 , ILE A:138 , TYR A:139 , GLN A:141 , PHE A:183 , TRP A:184 , ILE A:186 , BCL A:367 , BCL A:369 , BCL A:372 , BCL A:373 , HOH A:414 , HOH A:565	BINDING SITE FOR RESIDUE BCL A 368
4	AC4	SOFTWARE	ALA A:12 , TYR A:16 , ALA A:38 , PRO A:39 , PRO A:40 , ALA A:41 , ALA A:189 , PHE A:258 , SER A:260 , ILE A:265 , HIS A:298 , VAL A:301 , GLY A:302 , ASN A:305 , CYS A:353 , BCL A:368 , BCL A:370 , BCL A:372 , BCL A:373 , HOH A:568	BINDING SITE FOR RESIDUE BCL A 369
5	AC5	SOFTWARE	TYR A:16 , ILE A:18 , VAL A:30 , ALA A:32 , PHE A:258 , LEU A:288 , HIS A:290 , PRO A:294 , HIS A:298 , LEU A:313 , TYR A:345 , TRP A:348 , PHE A:360 , ILE A:362 , BCL A:369 , BCL A:371 , BCL A:373 , HOH A:513	BINDING SITE FOR RESIDUE BCL A 370
6	AC6	SOFTWARE	VAL A:55 , VAL A:65 , ARG A:238 , LEU A:242 , PRO A:244 , ALA A:256 , PHE A:273 , PRO A:274 , GLY A:275 , PRO A:291 , BCL A:370 , BCL A:372 , BCL A:373 , HOH A:424	BINDING SITE FOR RESIDUE BCL A 371
7	AC7	SOFTWARE	LEU A:53 , VAL A:55 , ILE A:84 , ALA A:86 , ILE A:88 , ARG A:96 , ILE A:97 , SER A:98 , GLY A:117 , VAL A:119 , GLN A:144 , HIS A:146 , TRP A:184 , PHE A:225 , SER A:235 , TRP A:239 , GLN A:253 , VAL A:254 , BCL A:368 , BCL A:369 , BCL A:371 , BCL A:373	BINDING SITE FOR RESIDUE BCL A 372
8	AC8	SOFTWARE	ALA A:41 , TYR A:139 , PHE A:185 , PRO A:188 , ALA A:189 , ALA A:192 , GLN A:198 , ILE A:293 , HIS A:297 , HIS A:298 , VAL A:301 , BCL A:368 , BCL A:369 , BCL A:370 , BCL A:371 , BCL A:372 , HOH A:403 , HOH A:474 , HOH A:568	BINDING SITE FOR RESIDUE BCL A 373
9	AC9	SOFTWARE	TYR A:124 , TYR A:125 , ASP A:161 , THR A:162 , THR A:166 , ALA A:169 , THR A:173 , PHE A:176 , TRP A:179 , ILE A:180 , PHE A:183 , HOH A:450	BINDING SITE FOR RESIDUE BCL A 400

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:359
 aligned with BCPA_CHLTE | Q46393 from UniProtKB/Swiss-Prot  Length:366

    Alignment length:359
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357         
           BCPA_CHLTE     8 DVTTAHSDYEIVLEGGSSSWGKVKARAKVNAPPASPLLPADCDVKLNVKPLDPAKGFVRISAVFESIVDSTKNKLTIEADIANETKERRISVGEGMVSVGDFSHTFSFEGSVVNLFYYRSDAVRRNVPNPIYMQGRQFHDILMKVPLDNNDLIDTWEGTVKAIGSTGAFNDWIRDFWFIGPAFTALNEGGQRISRIEVNGLNTESGPKGPVGVSRWRFSHGGSGMVDSISRWAELFPSDKLNRPAQVEAGFRSDSQGIEVKVDGEFPGVSVDAGGGLRRILNHPLIPLVHHGMVGKFNNFNVDAQLKVVLPKGYKIRYAAPQYRSQNLEEYRWSGGAYARWVEHVCKGGVGQFEILYAQ 366
               SCOP domains d3bsda_ A: automated matches                                                                                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains 3bsdA00 A:8-366 Bacteriochlorophyll-a Protein                                                                                                                                                                                                                                                                                                                           CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeee.......eeeeeeeee..........eeeeeeeeeeeee....eeeeeeeeeeee..eeeeeeeeeeeee....eeeeeeeeeeee..eeeeeeeeeeeeeee...hhhhhhhh.......eeeeeeeeeeee...hhhhhhhhhhhhhh....hhhhhhhhhhh..hhhhhhhhh.eee...eeeeee........eeeeeeeeeeee...hhhhhh.....hhhhh...eeeeeeeeee..eeeeeeeeee...eee.....eee...hhhhhhhhhh.......eeeeeeeee.....eeeee.....eee..eeeeehhhhhhhhhhhhhh......eeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3bsd A   8 DVTTAHSDYEIVLEGGSSSWGKVKARAKVNAPPASPLLPADCDVKLNVKPLDPAKGFVRISAVFESIVDSTKNKLTIEADIANETKERRISVGEGMVSVGDFSHTFSFEGSVVNLFYYRSDAVRRNVPNPIYMQGRQFHDILMKVPLDNNDLIDTWEGTVKAIGSTGAFNDWIRDFWFIGPAFTALNEGGQRISRIEVNGLNTESGPKGPVGVSRWRFSHGGSGMVDSISRWAELFPSDKLNRPAQVEAGFRSDSQGIEVKVDGEFPGVSVDAGGGLRRILNHPLIPLVHHGMVGKFNNFNVDAQLKVVLPKGYKIRYAAPQYRSQNLEEYRWSGGAYARWVEHVCKGGVGQFEILYAQ 366
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Asymmetric Unit(hide GO term definitions)

Chain A (BCPA_CHLTE | Q46393)

molecular function
	GO:0042314	bacteriochlorophyll binding	Interacting selectively and non-covalently with bacteriochlorophyll, a form of chlorophyll found in photosynthetic bacteria, such as the purple and green bacteria. There are several types, designated a to g. Bacteriochlorophyll a and bacteriochlorophyll b are structurally similar to the chlorophyll a and chlorophyll b found in plants.
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BCL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Leu A:45 - Pro A:46	[ RasMol ]
		Thr A:210 - Glu A:211	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3bsd
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BCPA_CHLTE \| Q46393
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 9)

Sites (9, 9)