Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF DROSOPHILA MELANOGASTER E47D DOPAMINE N-ACETYLTRANSFERASE IN TERNARY COMPLEX WITH COA AND ACETYL-PHENYLETHYLAMINE
 
Authors :  Y. C. Yang, C. Y. Wu, H. C. Cheng, P. C. Lyu
Date :  23 Jun 16  (Deposition) - 05 Jul 17  (Release) - 05 Jul 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.39
Chains :  Asym./Biol. Unit :  A
Keywords :  Dopamine N-Acetyltransferase(Dat), Gcn5-Related N- Acetyltransferase(Gnat), Arylalkylamine N-Acetyltransferase(Aanat), Order Bi-Bi Sequential Mechanism, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. C. Yang, C. Y. Wu, H. C. Cheng, P. C. Lyu
Crystal Structure Of Drosophila Melanogaster E47D Dopamine N-Acetyltransferase In Ternary Complex With Coa And Acetyl-Phenylethylamine
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - DOPAMINE N-ACETYLTRANSFERASE
    Chains: A
    EC Number: 2.3.1.87
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: K-12
    Expression System Taxid: 83333
    Fragment: UNP RESIDUES 56-265
    Gene: DAT, NAT1, CG3318
    Mutation: YES
    Organism Common: FRUIT FLY
    Organism Scientific: DROSOPHILA MELANOGASTER
    Organism Taxid: 7227
    Synonym: ARYLALKYLAMINE N-ACETYLTRANSFERASE,AANAT1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
154W1Ligand/IonN-(2-PHENYLETHYL)ACETAMIDE
2COA1Ligand/IonCOENZYME A

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:46 , ASP A:47 , PRO A:48 , LEU A:146 , SER A:147 , VAL A:148 , ARG A:153 , GLY A:154 , LEU A:155 , GLY A:156 , ILE A:157 , ALA A:158 , CYS A:181 , SER A:182 , SER A:186 , VAL A:189 , LYS A:192 , 54W A:302 , HOH A:423 , HOH A:428 , HOH A:434 , HOH A:443 , HOH A:446 , HOH A:448 , HOH A:449 , HOH A:459 , HOH A:469 , HOH A:493 , HOH A:510 , HOH A:535binding site for residue COA A 301
2AC2SOFTWAREASP A:47 , ASN A:50 , MET A:121 , GLY A:143 , LYS A:144 , ILE A:145 , LEU A:146 , VAL A:179 , LEU A:180 , COA A:301binding site for residue 54W A 302

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5GIH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5GIH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5GIH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5GIH)

(-) Exons   (0, 0)

(no "Exon" information available for 5GIH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:210
                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..eeeee....eeeeeeeeeee.........hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeeeee.hhhh..hhhhhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhh..eeeeeee.hhh..........hhhh.eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5gih A  21 PYTIELIQPEDGEAVIAMLKTFFFKDDPLNTFLDLGECKELEKYSLKPLPDNCSYKAVNKKGEIIGVFLNGLMRRPSPDDVPEKAADSCEHPKFKKILSLMDHVEEQFNIFDVYPDEELILDGKILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVFRMQFADYKPQGEVVFKPAAPHVGIQVMAKEV 230
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5GIH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5GIH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5GIH)

(-) Gene Ontology  (14, 14)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    54W  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    COA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5gih)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5gih
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DNAT_DROME | Q94521
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.87
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  DNAT_DROME | Q94521
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DNAT_DROME | Q94521: 3te4 3v8i 5gi5 5gi6 5gi7 5gi8 5gi9 5gif 5gig 5gii

(-) Related Entries Specified in the PDB File

5gif 5gig 5gii