Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF DROSOPHILA MELANOGASTER DOPAMINE N-ACETYLTRANSFERASE BOUND TO COA
 
Authors :  Y. C. Yang, H. C. Cheng, P. C. Lyu
Date :  22 Jun 16  (Deposition) - 05 Jul 17  (Release) - 05 Jul 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.45
Chains :  Asym./Biol. Unit :  A
Keywords :  Dopamine N-Acetyltransferase(Dat), Gcn5-Related N- Acetyltransferase(Gnat), Arylalkylamine N-Acetyltransferase(Aanat), Order Bi-Bi Sequential Mechanism, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. C. Yang, H. C. Cheng, P. C. Lyu
Crystal Structure Of Drosophila Melanogaster Dopamine N-Acetyltransferase Bound To Coa
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - DOPAMINE N-ACETYLTRANSFERASE
    ChainsA
    EC Number2.3.1.87
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainK-12
    Expression System Taxid83333
    FragmentUNP RESIDUES 56-265
    GeneDAT, NAT1, CG3318
    Organism CommonFRUIT FLY
    Organism ScientificDROSOPHILA MELANOGASTER
    Organism Taxid7227
    SynonymARYLALKYLAMINE N-ACETYLTRANSFERASE,AANAT1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
1COA1Ligand/IonCOENZYME A
2IMD1Ligand/IonIMIDAZOLE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:47 , ASN A:50binding site for residue IMD A 301
2AC2SOFTWAREASP A:46 , GLU A:47 , PRO A:48 , LEU A:146 , VAL A:148 , ARG A:153 , GLY A:154 , LEU A:155 , GLY A:156 , ILE A:157 , ALA A:158 , CYS A:181 , SER A:182 , SER A:183 , TYR A:185 , SER A:186 , ARG A:188 , VAL A:189 , LYS A:192 , GLU A:197 , VAL A:198 , HOH A:427 , HOH A:430 , HOH A:431 , HOH A:432 , HOH A:439 , HOH A:440 , HOH A:455 , HOH A:464 , HOH A:487 , HOH A:489 , HOH A:491 , HOH A:494 , HOH A:505 , HOH A:510binding site for residue COA A 302

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5GI5)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Ala A:218 -Pro A:219

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5GI5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5GI5)

(-) Exons   (0, 0)

(no "Exon" information available for 5GI5)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:209
                                                                                                                                                                                                                                                 
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh.eeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..eeeee....eeeeeeeeeee..........hhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeeeee.hhhh..hhhhhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhh..eeeeeee.hhhhhhhh..........eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5gi5 A  16 GPLGSPYTIELIQPEDGEAVIAMLKTFFFKDEPLNTFLDLGECKELEKYSLKPLPDNCSYKAVNKKGEIIGVFLNGLMRRPSPDADSCEHPKFKKILSLMDHVEEQFNIFDVYPDEELILDGKILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVFRMQFADYKPQGEVVFKPAAPHVGIQVMAKEV 230
                                    25        35        45        55        65        75        85        95   ||  111       121       131       141       151       161       171       181       191       201       211       221         
                                                                                                              99|                                                                                                                            
                                                                                                              106                                                                                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5GI5)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5GI5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5GI5)

(-) Gene Ontology  (14, 14)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    COA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IMD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:218 - Pro A:219   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5gi5
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DNAT_DROME | Q94521
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.87
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DNAT_DROME | Q94521
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DNAT_DROME | Q945213te4 3v8i 5gi6 5gi7 5gi8 5gi9 5gif 5gig 5gih 5gii

(-) Related Entries Specified in the PDB File

5gi6 5gi7 5gi8 5gi9