Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A CRENOMYTILUS GRAYANUS LECTIN
 
Authors :  J. -H. Liao, K. -F. Huang, I. -F. Tu, I. -M. Lee, S. -H. Wu
Date :  09 Dec 15  (Deposition) - 06 Apr 16  (Release) - 27 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.08
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Lectin, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. -H. Liao, C. -T. Chien, H. -Y. Wu, K. -F. Huang, I. Wang, M. -R. Ho, I. -F. Tu, I. -M. Lee, W. Li, Y. -L. Shih, C. -Y. Wu, P. A. Lukyanov, S. D. Hsu, S. -H. Wu
A Multivalent Marine Lectin From Crenomytilus Grayanus Possesses Anti-Cancer Activity Through Recognizing Globotriose Gb3
J. Am. Chem. Soc. V. 138 4787 2016
PubMed-ID: 27010847  |  Reference-DOI: 10.1021/JACS.6B00111

(-) Compounds

Molecule 1 - GALNAC/GAL-SPECIFIC LECTIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificCRENOMYTILUS GRAYANUS
    Organism Taxid151218

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 8)

Asymmetric/Biological Unit (1, 8)
No.NameCountTypeFull Name
1GOL8Ligand/IonGLYCEROL

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:75 , HIS A:108 , PRO A:109 , LYS A:110 , GLY A:111 , GLY A:112 , HIS A:129 , HOH A:334 , HOH A:398binding site for residue GOL A 201
2AC2SOFTWAREASN A:27 , HIS A:64 , PRO A:65 , TYR A:66 , GLY A:67 , GLY A:68 , HIS A:81 , HIS A:85 , GOL A:204 , HOH A:379binding site for residue GOL A 202
3AC3SOFTWAREHIS A:16 , PRO A:17 , TYR A:18 , GLY A:19 , GLY A:20 , HIS A:33 , HIS A:37 , ASN A:119 , HOH A:382 , HOH A:384binding site for residue GOL A 203
4AC4SOFTWAREASN A:27 , TYR A:66 , GLY A:67 , GOL A:202 , HOH A:307 , HOH A:312binding site for residue GOL A 204
5AC5SOFTWAREHOH A:320 , HIS B:16 , PRO B:17 , GLY B:19 , GLY B:20 , HIS B:33 , ASP B:35 , HIS B:37 , ASN B:119binding site for residue GOL B 201
6AC6SOFTWAREHOH A:402 , HOH A:476 , HOH A:646 , GLU B:75 , HIS B:108 , GLY B:112 , HIS B:125 , ASP B:127 , HIS B:129binding site for residue GOL B 202
7AC7SOFTWAREASN A:71 , ASN B:27 , HIS B:64 , GLY B:67 , GLY B:68 , HIS B:81 , ASP B:83 , HIS B:85 , GOL B:204binding site for residue GOL B 203
8AC8SOFTWAREASN A:71 , HOH A:544 , HOH A:592 , ASN B:27 , TYR B:66 , GLY B:67 , HIS B:81 , GOL B:203binding site for residue GOL B 204

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5F8S)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5F8S)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5F8S)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5F8S)

(-) Exons   (0, 0)

(no "Exon" information available for 5F8S)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:149
                                                                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....eeee..........eeeeee...hhhh.eeeeeee..eeeeee.....eeee............eeee...hhhh.eeee....eeee....eeee..........eeeeee...hhhh.eeeee..eeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f8s A   2 TTFLIKHKASGKFLHPYGGSSNPANNTKLVLHSDIHERMYFQFDVVDERWGYIKHVASGKIVHPYGGQANPPNETNMVLHQDRHDRALFAMDFFNDNIMHKGGKYIHPKGGSPNPPNNTETVIHGDKHAAMEFIFVSPKNKDKRVLVYA 150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141         

Chain B from PDB  Type:PROTEIN  Length:149
                                                                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....eeee..........eeeeee...hhhh.eeeeeee..eeeeee.....eeee............eeee...hhhh.eeee....eeee....eeee..........eeeeee...hhhh.eeeee..eeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f8s B   2 TTFLIKHKASGKFLHPYGGSSNPANNTKLVLHSDIHERMYFQFDVVDERWGYIKHVASGKIVHPYGGQANPPNETNMVLHQDRHDRALFAMDFFNDNIMHKGGKYIHPKGGSPNPPNNTETVIHGDKHAAMEFIFVSPKNKDKRVLVYA 150
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5F8S)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5F8S)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5F8S)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5f8s)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5f8s
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  H2FH31_9BIVA | H2FH31
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  H2FH31_9BIVA | H2FH31
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        H2FH31_9BIVA | H2FH315duy 5f8w 5f8y 5f90

(-) Related Entries Specified in the PDB File

5f8w 5f8y 5f90