Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  SANDERCYANIN FLUORESCENT PROTEIN PURIFIED FROM SANDER VITREUS
 
Authors :  S. Ghosh, C. L. Yu, D. Ferraro, S. Sudha, S. Pal, W. Schaefer, D. T. Gibson R. Subramanian
Date :  07 Dec 15  (Deposition) - 28 Sep 16  (Release) - 26 Oct 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.25
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Sandercyanin Fluorescent Protein (Sfp), Walleye, Lipocalin, Photo- Stability, Red Fluorescent Protein, Fluorescent Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Ghosh, C. L. Yu, D. J. Ferraro, S. Sudha, S. K. Pal, W. F. Schaefer, D. T. Gibson, S. Ramaswamy
Blue Protein With Red Fluorescence
Proc. Natl. Acad. Sci. Usa V. 113 11513 2016
PubMed-ID: 27688756  |  Reference-DOI: 10.1073/PNAS.1525622113

(-) Compounds

Molecule 1 - SANDERCYANIN FLUORESCENT PROTEIN
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: SANDER VITREUS
    Organism Taxid: 283036

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric/Biological Unit (2, 8)
No.NameCountTypeFull Name
1BLA4Ligand/IonBILIVERDINE IX ALPHA
2NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:20 , PHE A:55 , THR A:62 , ALA A:63 , ASN A:77 , GLU A:79 , LYS A:87 , VAL A:89 , HIS A:108 , VAL A:114 , TYR A:116 , SER A:131 , TYR A:142 , HOH A:301 , HOH A:331 , LEU D:135 , ALA D:137 , HOH D:342binding site for residue BLA A 201
2AC2SOFTWARESER B:20 , ASP B:47 , PHE B:55 , THR B:62 , ALA B:63 , ASN B:77 , ARG B:78 , GLU B:79 , LYS B:87 , SER B:88 , VAL B:89 , HIS B:108 , ALA B:111 , TYR B:116 , SER B:131 , TYR B:142 , HOH B:310 , LEU C:135 , GLY C:136 , ALA C:137binding site for residue BLA B 201
3AC3SOFTWARELEU B:135 , GLY B:136 , ALA B:137 , SER C:20 , PHE C:55 , THR C:62 , ALA C:63 , ASN C:77 , ARG C:78 , GLU C:79 , LYS C:87 , SER C:88 , VAL C:89 , HIS C:108 , VAL C:114 , TYR C:116 , SER C:131 , TYR C:142 , SER C:144 , HOH C:333binding site for residue BLA C 201
4AC4SOFTWARELEU A:135 , GLY A:136 , ALA A:137 , SER D:20 , PHE D:55 , THR D:62 , ALA D:63 , ASN D:77 , ARG D:78 , GLU D:79 , LYS D:87 , VAL D:89 , HIS D:108 , VAL D:114 , SER D:131 , TYR D:142 , HOH D:313 , HOH D:326 , HOH D:331binding site for residue BLA D 201
5AC5SOFTWAREASN A:83 , THR A:85 , HOH A:310binding site for Mono-Saccharide NAG A 202 bound to ASN A 83
6AC6SOFTWAREASN B:83 , THR B:85 , HOH B:314 , HOH B:336binding site for Mono-Saccharide NAG B 202 bound to ASN B 83
7AC7SOFTWAREASN C:83 , THR C:85 , HOH C:305binding site for Mono-Saccharide NAG C 202 bound to ASN C 83
8AC8SOFTWAREASN D:83 , THR D:85 , HOH D:320 , HOH D:346binding site for Mono-Saccharide NAG D 202 bound to ASN D 83

(-) SS Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1A:27 -A:132
2A:60 -A:184
3B:27 -B:132
4B:60 -B:184
5C:27 -C:132
6C:60 -C:184
7D:27 -D:132
8D:60 -D:184

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5F6Z)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5F6Z)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5F6Z)

(-) Exons   (0, 0)

(no "Exon" information available for 5F6Z)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:166
                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee............hhhhhheeeeeeee........eeeeeeeee.....eeeeeeee.....eeeeeeeee........eeeeee.....eeeeeeee....eeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhhhhh..hhhhhee...hhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f6z A  20 SFIKPGRCPKPAVQEDFDAARYLGVWYDIQRLPNKFQKGECATATYSLSPGVGFSVFNRERLANGTIKSVIGSAIAEDPCEPAKLQFFHENAAPVPYWVLSTDYDNYALVYSCINLGASHAAYASIVSRQPTLPEETIKKLQGTMSSFGVGVDTLLTTNQDAAYCS 185
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179      


Chain B from PDB  Type:PROTEIN  Length:166
                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee............hhhhhheeeeeeee........eeeeeeeee.....eeeeeeee.....eeeeeeeee........eeeeee.....eeeeeeee....eeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhhhhh..hhhhhee...hhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f6z B  20 SFIKPGRCPKPAVQEDFDAARYLGVWYDIQRLPNKFQKGECATATYSLSPGVGFSVFNRERLANGTIKSVIGSAIAEDPCEPAKLQFFHENAAPVPYWVLSTDYDNYALVYSCINLGASHAAYASIVSRQPTLPEETIKKLQGTMSSFGVGVDTLLTTNQDAAYCS 185
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179      


Chain C from PDB  Type:PROTEIN  Length:166
                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee............hhhhhheeeeeeee........eeeeeeeee.....eeeeeeee.....eeeeeeeee........eeeeee.....eeeeeeee....eeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhhhhh..hhhhhee...hhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f6z C  20 SFIKPGRCPKPAVQEDFDAARYLGVWYDIQRLPNKFQKGECATATYSLSPGVGFSVFNRERLANGTIKSVIGSAIAEDPCEPAKLQFFHENAAPVPYWVLSTDYDNYALVYSCINLGASHAAYASIVSRQPTLPEETIKKLQGTMSSFGVGVDTLLTTNQDAAYCS 185
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179      


Chain D from PDB  Type:PROTEIN  Length:166
                                                                                                                                                                                                      
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee............hhhhh.eeeeeeee........eeeeeeeee.....eeeeeeee.....eeeeeeeeee.......eeeeee.....eeeeeeee....eeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhhhhh..hhhhhee...hhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5f6z D  20 SFIKPGRCPKPAVQEDFDAARYLGVWYDIQRLPNKFQKGECATATYSLSPGVGFSVFNRERLANGTIKSVIGSAIAEDPCEPAKLQFFHENAAPVPYWVLSTDYDNYALVYSCINLGASHAAYASIVSRQPTLPEETIKKLQGTMSSFGVGVDTLLTTNQDAAYCS 185
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5F6Z)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5F6Z)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5F6Z)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5F6Z)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BLA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5f6z)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5f6z
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A1D5B369_S | A0A1D5B369
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A0A1D5B369_S | A0A1D5B369
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5F6Z)

(-) Related Entries Specified in the PDB File

5ez2 5EZ2 CONTAINS THE SAME PROTEIN PURIFIED FROM RECOMBINANT SOURCE