Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  SANDERCYANIN FLUORESCENT PROTEIN (SFP)
 
Authors :  S. Ghosh, S. Ramaswamy
Date :  26 Nov 15  (Deposition) - 28 Sep 16  (Release) - 26 Oct 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Sandercyanin, Red-Fluorescent Protein, Lipocalin, Biliverdin, Photo- Stability, Fluorescent Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Ghosh, C. L. Yu, D. J. Ferraro, S. Sudha, S. K. Pal, W. F. Schaefer, D. T. Gibson, S. Ramaswamy
Blue Protein With Red Fluorescence
Proc. Natl. Acad. Sci. Usa V. 113 11513 2016
PubMed-ID: 27688756  |  Reference-DOI: 10.1073/PNAS.1525622113

(-) Compounds

Molecule 1 - SANDERCYANIN FLUORESCENT PROTEIN
    Cell LineMUCOSA
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET21A
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificSANDER VITREUS
    Organism Taxid283036
    TissueMUCUS

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 7)

Asymmetric Unit (2, 7)
No.NameCountTypeFull Name
1BLA2Ligand/IonBILIVERDINE IX ALPHA
2EDO5Ligand/Ion1,2-ETHANEDIOL
Biological Unit 1 (2, 14)
No.NameCountTypeFull Name
1BLA4Ligand/IonBILIVERDINE IX ALPHA
2EDO10Ligand/Ion1,2-ETHANEDIOL

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:47 , PHE A:55 , ASN A:77 , ARG A:78 , GLU A:79 , LYS A:87 , VAL A:89 , HIS A:108 , ALA A:111 , SER A:131 , LEU A:135 , GLY A:136 , ALA A:137 , TYR A:142 , VAL A:146 , HOH A:402 , HOH A:405 , HOH A:424 , HOH A:435 , HOH A:476binding site for residue BLA A 301
2AC2SOFTWARECYS A:27 , PRO A:28 , PRO A:115 , TRP A:117 , SER A:131 , CYS A:132 , HOH A:474binding site for residue EDO A 302
3AC3SOFTWARELYS A:54 , PHE A:55 , HOH A:404 , HOH A:424binding site for residue EDO A 303
4AC4SOFTWAREASP B:47 , PHE B:55 , ASN B:77 , ARG B:78 , GLU B:79 , LYS B:87 , VAL B:89 , HIS B:108 , ALA B:111 , SER B:131 , LEU B:135 , GLY B:136 , ALA B:137 , TYR B:142 , VAL B:146 , HOH B:402 , HOH B:404 , HOH B:410 , HOH B:412 , HOH B:457 , HOH B:491binding site for residue BLA B 301
5AC5SOFTWAREPHE B:21 , LYS B:54 , HOH B:412binding site for residue EDO B 302
6AC6SOFTWAREPRO B:28 , PRO B:115 , TRP B:117 , CYS B:132binding site for residue EDO B 303
7AC7SOFTWAREILE B:48 , THR B:151 , LEU B:152 , THR B:176 , HOH B:427binding site for residue EDO B 304

(-) SS Bonds  (4, 4)

Asymmetric Unit
No.Residues
1A:27 -A:132
2A:60 -A:184
3B:27 -B:132
4B:60 -B:184

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5EZ2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5EZ2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5EZ2)

(-) Exons   (0, 0)

(no "Exon" information available for 5EZ2)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:169
                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee............hhhhhheeeeeeee........eeeeeeeee.....eeeeeeee.....eeeeeeeee........eeeeee.....eeeeeeee....eeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhhhhh..hhhhhee.......hhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ez2 A  20 MFIKPGRCPKPAVQEDFDAARYLGVWYDIQRLPNKFQKGECATATYSLSPGVGFSVFNRERLANGTIKSVIGSAIAEDPCEPAKLQFFHENAAPVPYWVLSTDYDNYALVYSCINLGASHAAYASIVSRQPTLPEETIKKLQGTMSSFGVGVDTLLTTNQDAAYCSAMN 188
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179         

Chain B from PDB  Type:PROTEIN  Length:169
                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee............hhhhhheeeeeeee........eeeeeeeee.....eeeeeeee.....eeeeeeeee........eeeeee.....eeeeeeee....eeeeeeeeee..eeeeeeeeee.....hhhhhhhhhhhhhhh..hhhhhee.......hhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ez2 B  20 MFIKPGRCPKPAVQEDFDAARYLGVWYDIQRLPNKFQKGECATATYSLSPGVGFSVFNRERLANGTIKSVIGSAIAEDPCEPAKLQFFHENAAPVPYWVLSTDYDNYALVYSCINLGASHAAYASIVSRQPTLPEETIKKLQGTMSSFGVGVDTLLTTNQDAAYCSAMN 188
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5EZ2)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5EZ2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5EZ2)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5EZ2)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BLA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ez2)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ez2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A1D5B367_S | A0A1D5B367
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A0A1D5B367_S | A0A1D5B367
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A0A1D5B367_S | A0A1D5B3675f1e

(-) Related Entries Specified in the PDB File

5f1e