Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  2009 H1N1 PA ENDONUCLEASE MUTANT F105S IN COMPLEX WITH L-742,001
 
Authors :  G. Kumar, S. W. White
Date :  18 Aug 15  (Deposition) - 16 Mar 16  (Release) - 13 Apr 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym./Biol. Unit :  A
Keywords :  Influenza, Resistance, Endonuclease Inhibitor, Viral Protein, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. S. Song, G. Kumar, W. R. Shadrick, W. Zhou, T. Jeevan, Z. Li, P. J. Slavish, T. P. Fabrizio, S. W. Yoon, T. R. Webb, R. J. Webby, S. W. White
Identification And Characterization Of Influenza Variants Resistant To A Viral Endonuclease Inhibitor.
Proc. Natl. Acad. Sci. Usa V. 113 3669 2016
PubMed-ID: 26976575  |  Reference-DOI: 10.1073/PNAS.1519772113

(-) Compounds

Molecule 1 - POLYMERASE ACIDIC PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET52B
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    FragmentENDONUCLEASE DOMAIN (UNP RESIDUES 1-50, 73-196 CONNECTED BY GGS LINKER)
    GenePA
    MutationYES
    Organism ScientificINFLUENZA A VIRUS
    Organism Taxid641501
    StrainSWL A/CALIFORNIA/04/2009 H1N1
    SynonymPA ENDONUCLEASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric/Biological Unit (2, 3)
No.NameCountTypeFull Name
10N81Ligand/Ion(2Z)-4-[1-BENZYL-4-(4-CHLOROBENZYL)PIPERIDIN-4-YL]-2-HYDROXY-4-OXOBUT-2-ENOIC ACID
2MN2Ligand/IonMANGANESE (II) ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:41 , ASP A:89 , GLU A:100 , ILE A:101 , 0N8 A:203binding site for residue MN A 201
2AC2SOFTWAREGLU A:61 , ASP A:89 , 0N8 A:203 , HOH A:313 , HOH A:333binding site for residue MN A 202
3AC3SOFTWAREILE A:38 , HIS A:41 , GLU A:61 , ASP A:89 , GLU A:100 , ILE A:101 , LYS A:115 , MN A:201 , MN A:202 , HOH A:313 , HOH A:329 , HOH A:333binding site for residue 0N8 A 203

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5D9J)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5D9J)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5D9J)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5D9J)

(-) Exons   (0, 0)

(no "Exon" information available for 5D9J)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:179
                                                                                                                                                                                                                   
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....eee....hhhhhhhhhhhhhhhhh.........eee....eeeeeeee..hhhhhhhhhhhhhh....eeeeee....eee.hhh...hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d9j A   1 MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEVCFMYSDGGSKHRFEIIEGRDRIMAWTVVNSICNTTGVEKPKSLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRSLWDSFRQSERAA 179
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5D9J)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5D9J)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5D9J)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    0N8  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5d9j)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5d9j
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  C3W5S0_I09A0 | C3W5S0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  C3W5S0_I09A0 | C3W5S0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        C3W5S0_I09A0 | C3W5S04avg 4avl 4avq 4awf 4awg 4awh 4awk 4awm 5ccy 5cgv 5cl0 5czn 5d2o 5d42 5d4g 5d8u 5dbs 5deb 5des 5ega

(-) Related Entries Specified in the PDB File

5ccy 5cgv 5cl0 5czn 5d2o 5d42 5d4g 5d8u