Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF HIV-1 REVERSE TRANSCRIPTASE BOUND TO A NOVEL 38-MER HAIRPIN TEMPLATE-PRIMER DNA APTAMER
 
Authors :  M. T. Miller, S. Tuske, K. Das, E. Arnold
Date :  06 Aug 15  (Deposition) - 30 Sep 15  (Release) - 13 Jan 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B,E  (1x)
Biol. Unit 2:  C,D,F  (1x)
Keywords :  Reverse Transcriptase, Hiv, Dna Aptamer, 2-O-Methylcytidine, P66, P51, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. T. Miller, S. Tuske, K. Das, J. J. Destefano, E. Arnold
Structure Of Hiv-1 Reverse Transcriptase Bound To A Novel 38-Mer Hairpin Template-Primer Dna Aptamer.
Protein Sci. V. 25 46 2016
PubMed-ID: 26296781  |  Reference-DOI: 10.1002/PRO.2776

(-) Compounds

Molecule 1 - HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
    Chains: A, C
    EC Number: 2.7.7.49
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: GAG-POL
    Mutation: YES
    Organism Common: HIV-1
    Organism Scientific: HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 GROUP M SUBTYPE B (ISOLATE BH10)
    Organism Taxid: 11678
    Strain: ISOLATE BH10
    Synonym: PR160GAG-POL
 
Molecule 2 - HIV-1 REVERSE TRANSCRIPTASE P51 SUBUNIT
    Chains: B, D
    EC Number: 2.7.7.49
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: GAG-POL
    Mutation: YES
    Organism Common: HIV-1
    Organism Scientific: HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 GROUP M SUBTYPE B (ISOLATE BH10)
    Organism Taxid: 11678
    Strain: ISOLATE BH10
    Synonym: PR160GAG-POL
 
Molecule 3 - DNA APTAMER (38-MER)
    Chains: F, E
    Engineered: YES
    Organism Scientific: SYNTHETIC CONSTRUCT
    Organism Taxid: 32630
    Synthetic: YES

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): AB  E 
Biological Unit 2 (1x):   CD F

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 21)

Asymmetric Unit (5, 21)
No.NameCountTypeFull Name
1GOL11Ligand/IonGLYCEROL
2OMC4Mod. NucleotideO2'-METHYLYCYTIDINE-5'-MONOPHOSPHATE
3SO42Ligand/IonSULFATE ION
4SUC2Ligand/IonSUCROSE
5TMP2Mod. NucleotideTHYMIDINE-5'-PHOSPHATE
Biological Unit 1 (5, 11)
No.NameCountTypeFull Name
1GOL6Ligand/IonGLYCEROL
2OMC2Mod. NucleotideO2'-METHYLYCYTIDINE-5'-MONOPHOSPHATE
3SO41Ligand/IonSULFATE ION
4SUC1Ligand/IonSUCROSE
5TMP1Mod. NucleotideTHYMIDINE-5'-PHOSPHATE
Biological Unit 2 (5, 10)
No.NameCountTypeFull Name
1GOL5Ligand/IonGLYCEROL
2OMC2Mod. NucleotideO2'-METHYLYCYTIDINE-5'-MONOPHOSPHATE
3SO41Ligand/IonSULFATE ION
4SUC1Ligand/IonSUCROSE
5TMP1Mod. NucleotideTHYMIDINE-5'-PHOSPHATE

(-) Sites  (25, 25)

Asymmetric Unit (25, 25)
No.NameEvidenceResiduesDescription
01AC1SOFTWARELYS A:331 , GLY A:333 , GLN A:334binding site for residue SO4 A 601
02AC2SOFTWARELEU A:429 , GLU A:430 , GLN A:507 , TYR A:532 , LEU A:533 , LYS B:259binding site for residue GOL A 602
03AC3SOFTWARETRP B:24 , ARG B:78 , GLU B:79 , LYS B:82 , LYS B:395 , GLU B:399 , GLU B:413 , TRP B:414 , PHE B:416 , HOH B:2136 , HOH B:2146 , HOH B:2178binding site for residue SUC B 2001
04AC4SOFTWAREGLY B:316 , VAL B:317 , TYR B:318 , LYS B:323 , HOH B:2114 , HOH B:2135binding site for residue GOL B 2002
05AC5SOFTWARETRP B:24 , GLU B:399 , TRP B:402 , HOH B:2136 , HOH B:2140binding site for residue GOL B 2003
06AC6SOFTWARELEU A:92 , VAL A:381 , GLN B:23 , TRP B:24 , PRO B:25 , PRO B:133 , ASN B:137 , HOH B:2139 , HOH B:2141 , HOH B:2176 , HOH B:2192binding site for residue GOL B 2004
07AC7SOFTWAREGLN A:407 , ALA A:408 , THR A:409 , ILE B:393 , GLN B:394 , THR B:397 , HOH B:2106binding site for residue GOL B 2005
08AC8SOFTWARELYS B:64 , GLU B:404 , TRP B:406 , GLN B:407 , HOH B:2132 , HOH B:2133binding site for residue GOL B 2006
09AC9SOFTWARELYS C:331 , GLN C:334 , HOH C:733binding site for residue SO4 C 601
10AD1SOFTWARELYS C:366 , THR C:369 , GLU C:370 , ALA C:408 , THR C:409 , HOH C:703 , HOH C:749 , GLN D:394 , THR D:397binding site for residue GOL C 602
11AD2SOFTWAREASP D:76 , ARG D:78 , GLU D:79 , LYS D:82 , LYS D:395 , GLU D:399 , GLU D:413 , TRP D:414 , PHE D:416 , GOL D:504 , HOH D:653binding site for residue SUC D 501
12AD3SOFTWARETRP D:266 , GLU D:328 , GLN D:340 , TYR D:342 , PHE D:346 , ASN D:348binding site for residue GOL D 502
13AD4SOFTWARELEU C:92 , VAL C:381 , GLN D:23 , PRO D:25 , ASN D:137 , HOH D:613 , HOH D:614 , HOH D:631 , HOH D:643binding site for residue GOL D 503
14AD5SOFTWARETRP D:24 , GLU D:399 , TRP D:402 , SUC D:501 , HOH D:611 , HOH D:671 , HOH D:674binding site for residue GOL D 504
15AD6SOFTWAREDC F:5 , DG F:30binding site for residue GOL F 101
16AD7SOFTWAREARG A:78 , ASN A:81 , GLU A:89 , GLY A:152 , LYS A:154 , PRO A:157 , MET A:184 , DA E:0 , DC E:3 , DG E:32 , DG E:33binding site for Di-nucleotide DC E 1 and OMC E 2
17AD8SOFTWAREGLU A:89 , GLN A:91 , ILE A:94 , LYS A:154 , PRO A:157 , TYR A:183 , MET A:184 , DC E:1 , OMC E:4 , DG E:31 , DG E:32 , DG E:33binding site for Di-nucleotide OMC E 2 and DC E 3
18AD9SOFTWAREGLU A:89 , GLN A:91 , LEU A:92 , ILE A:94 , TYR A:183 , LYS B:22 , OMC E:2 , DC E:5 , DG E:30 , DG E:31 , DG E:32 , HOH E:106binding site for Di-nucleotide DC E 3 and OMC E 4
19AE1SOFTWARELEU A:92 , ILE A:94 , LYS B:22 , DC E:3 , DC E:6 , DG E:29 , DG E:30 , DG E:31 , HOH E:106binding site for Di-nucleotide OMC E 4 and DC E 5
20AE2SOFTWARETRP A:24 , PHE A:61 , LEU A:74 , VAL A:75 , ASP A:76 , ARG A:78 , GLN A:151 , GLY A:152 , DC E:1 , HOH E:111binding site for Di-nucleotide TMP E -1 and DA E 0
21AE3SOFTWAREARG C:78 , ASN C:81 , GLU C:89 , GLY C:152 , LYS C:154 , PRO C:157 , MET C:184 , DA F:0 , DC F:3 , DG F:32 , DG F:33binding site for Di-nucleotide DC F 1 and OMC F 2
22AE4SOFTWAREGLU C:89 , GLN C:91 , ILE C:94 , LYS C:154 , PRO C:157 , TYR C:183 , MET C:184 , DC F:1 , OMC F:4 , DG F:31 , DG F:32 , DG F:33binding site for Di-nucleotide OMC F 2 and DC F 3
23AE5SOFTWAREGLU C:89 , GLN C:91 , LEU C:92 , ILE C:94 , TYR C:183 , HOH C:767 , LYS D:22 , OMC F:2 , DC F:5 , DG F:30 , DG F:31 , DG F:32binding site for Di-nucleotide DC F 3 and OMC F 4
24AE6SOFTWARELEU C:92 , ILE C:94 , HOH C:767 , LYS D:22 , DC F:3 , DC F:6 , DG F:29 , DG F:30 , DG F:31 , GOL F:101binding site for Di-nucleotide OMC F 4 and DC F 5
25AE7SOFTWARETRP C:24 , PHE C:61 , LEU C:74 , VAL C:75 , ASP C:76 , ARG C:78 , GLN C:151 , GLY C:152 , DC F:1 , HOH F:206binding site for Di-nucleotide TMP F -1 and DA F 0

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5D3G)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Pro A:225 -Pro A:226
2Pro A:420 -Pro A:421
3Pro C:225 -Pro C:226
4Pro C:420 -Pro C:421

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5D3G)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5D3G)

(-) Exons   (0, 0)

(no "Exon" information available for 5D3G)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:553
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........................hhhhhhhhhhhhhhhhhh..ee...........eeeee......eeeee.hhhhhhhh...........hhhhh....eeeeee...hhhhh.....hhhhhheee.........eeeee........hhhhhhhhhhhhhhhhhhhh....eeeee..eeeeee..hhhhhhhhhhhhhhhhhhh....hhhhh.....eee..eee....eee..........eehhhhhhhhhhhhhhh.......hhhhhhhhh.......ee..hhhhhhhhhhhhhhhh..............eeeeeeee..eeeeeee.....eeeeeee......eehhhhhhhhhhhhhhhhhhhhh....eeee..hhhhhhhhhhhh........eee.....................eeeeeeeee.....eeeeeeee....eeeeeee..hhhhhhhhhhhhhhhh...eeeeee.hhhhhhhhh....ee.hhhhhhhhhhhhhh.eeeeee......hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d3g A   1 PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS 553
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550   


Chain B from PDB  Type:PROTEIN  Length:415
                                                                                                                                                                                                                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhhhhhh..eee..........eeee........eeee.hhhhhhhh....................eeeeee.hhhhhhh..hhhhhhhhheee.hhhhh...eeeee.......hhhhhhhhhhhhhhhhhhhhhh...eeeee..eeeeee..hhhhhhhhhhhhhhhhhhhhhh......eeehhhhh............eehhhhhhhhhhhhhhh.......hhhhhhh.........ee..hhhhhhhhhhhhhhhhh.............eeeeeeee..eeeeeee.....eeeeeee........hhhhhhhhhhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhh.......eeee........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d3g B   4 PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ 428
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213 ||    233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423     
                                                                                                                                                                                                                                             215|                                                                                                                                                                                                          
                                                                                                                                                                                                                                              226                                                                                                                                                                                                          


Chain C from PDB  Type:PROTEIN  Length:553
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........................hhhhhhhhhhhhhhhhhhh.eee..........eeeee......eeeee.hhhhhhhh...........hhhhh....eeeeee...hhhhh.....hhhhhhee...........eeee........hhhhhhhhhhhhhhhhhhhh....eeeee..eeeeee..hhhhhhhhhhhhhhhhhh.....hhhhh.....eee..eee....eee..........eehhhhhhhhhhhhhhh.......hhhhhhh.........ee..hhhhhhhhhhhhhhhhh.............eeeeeeee..eeeeeee.....eeeeeee......eehhhhhhhhhhhhhhhhhhhhh....eeee..hhhhhhhhhhhh........eee.....................eeeeeeeee.....eeeeeeee....eeeeeee..hhhhhhhhhhhhhhhh...eeeeee.hhhhhhhhhh...ee.hhhhhhhhhhhhhh.eeeeee......hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d3g C   1 PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS 553
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550   


Chain D from PDB  Type:PROTEIN  Length:410
                                                                                                                                                                                                                                                                                                                                                                                                                                                          
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................hhhhhhhhhhhhhhhhhh..eee..........eeee........eeee.hhhhhhhh..............hhhhh.eeeeee.hhhhhhh..hhhhhhhhheee.hhhhh...eeeee.......hhhhhhhhhhhhhhhhhhhhhh...eeeee..eeeeee..hhhhhhhhhhhhhhhhhhhh......eeehhhhh.............hhhhhhhhhhhhhhhh.......hhhhhhh.............hhhhhhhhhhhhhhhhh.............eeeeeeee..eeeeeee.....eeeeeee........hhhhhhhhhhhhhhhhhhhhhh...eeee..hhhhhhhhhhhhh.......eee........... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d3g D   6 ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY 427
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427
                                                                                                                                                                                                                                         213|                                                                                                                                                                                                         
                                                                                                                                                                                                                                          226                                                                                                                                                                                                         


Chain E from PDB  Type:DNA/RNA  Length:35
                                                                   
                 5d3g E  -1 xACcCcCCCTTCGGTGCTTTGCACCGAAGGGGGGG  33
                            |  | |   8        18        28     
                           -1-TMP|                             
                               2-OMC                           
                                 4-OMC                         


Chain F from PDB  Type:DNA/RNA  Length:35
                                                                   
                 5d3g F  -1 xACcCcCCCTTCGGTGCTTTGCACCGAAGGGGGGG  33
                            |  | |   8        18        28     
                           -1-TMP|                             
                               2-OMC                           
                                 4-OMC
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5D3G)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5D3G)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5D3G)

(-) Gene Ontology  (45, 45)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OMC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SUC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TMP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
    AE7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:225 - Pro A:226   [ RasMol ]  
    Pro A:420 - Pro A:421   [ RasMol ]  
    Pro C:225 - Pro C:226   [ RasMol ]  
    Pro C:420 - Pro C:421   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5d3g
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  POL_HV1B1 | P03366
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.49
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  POL_HV1B1 | P03366
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        POL_HV1B1 | P03366: 1a9m 1ajv 1ajx 1axa 1bqm 1bqn 1d4h 1d4i 1d4j 1dlo 1dw6 1ebk 1ebw 1eby 1ebz 1ec0 1ec1 1ec2 1ec3 1eet 1g35 1gnm 1gnn 1gno 1har 1hbv 1hef 1heg 1hih 1hmv 1hni 1hnv 1hos 1hps 1hpz 1hqe 1hqu 1hrh 1hte 1htf 1htg 1hvi 1hvk 1hvp 1hvu 1hys 1ikv 1ikw 1ikx 1iky 1j5o 1kjh 1mer 1mes 1met 1meu 1n5y 1n6q 1npa 1npv 1npw 1qe1 1qmc 1r0a 1rdh 1rtd 1rvl 1rvm 1rvn 1rvo 1rvp 1rvq 1rvr 1s6p 1s6q 1s9e 1s9g 1sbg 1suq 1sv5 1t03 1t05 1t7k 1tv6 1tvr 1uwb 1w5v 1w5w 1w5x 1w5y 1yt9 1zp8 1zpa 1zsf 1zsr 2aqu 2b5j 2b6a 2ban 2bbb 2be2 2exf 2fde 2g69 2hb3 2hmi 2hnz 2hs1 2hs2 2i4d 2i4u 2i4v 2i4w 2i4x 2i5j 2iaj 2ic3 2idw 2ien 2ieo 2jzw 2l45 2l46 2l4l 2uxz 2uy0 2vg5 2vg6 2vg7 2wkz 2wl0 2x4u 2xye 2xyf 2ykm 2ykn 2zd1 2ze2 3avi 3bgr 3dlk 3gga 3ggv 3ggx 3hvt 3ig1 3irx 3is9 3isn 3ith 3jsm 3jyt 3k2p 3k4v 3kle 3klf 3klg 3klh 3kli 3ndt 3nu3 3nu4 3nu5 3nu6 3nu9 3nuj 3nuo 3ok9 3psu 3qaa 3qlh 3qo9 3tkg 3tkw 3tl9 3tlh 3v4i 3v6d 3v81 3zps 3zpt 3zpu 4coe 4cp7 4cpq 4cpr 4cps 4cpt 4cpu 4cpw 4cpx 4dg1 4g1q 4g8g 4g8i 4g9d 4g9f 4h4m 4h4o 4i2p 4i2q 4icl 4id5 4idk 4ifv 4ify 4ig0 4ig3 4kfb 4kko 4ko0 4lsl 4lsn 4mfb 4o44 4o4g 4ojr 4pqu 4puo 4pwd 4q0b 4qag 4r5p 4rw4 4rw6 4rw7 4rw8 4rw9 4u8w 4we1 4ye3 4yhq 4zip 4zls 5agz 5ah6 5ah7 5ah8 5ah9 5aha 5ahb 5ahc 5bry 5bs4 5c24 5c25 5c42 5cym 5cyq 5fdl 5hbm 5hlf 5hp1 5hro 5i3u 5i42 5j1e 5jfp 5jfu 5jg1 5t6z 5t70 5tep 5ter 5tuq 5tw3 5txl 5txm 5txn 5txo 5txp

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5D3G)