Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF STAPHYLOCOCCAL SUPERANTIGEN-LIKE PROTEIN 3
 
Authors :  L. J. Feitsma, E. G. Huizinga
Date :  06 Aug 15  (Deposition) - 19 Aug 15  (Release) - 09 Sep 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.94
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Superantigens, Superantigen-Like Proteins, Ssl, Ssl3, Toll-Like Receptor 2, Tlr2, Immunology, Inflammation, Inhibition, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. J. Koymans, L. J. Feitsma, T. H. Brondijk, P. C. Aerts, E. Lukkien, P. Lossl, K. P. Van Kessel, C. J. De Haas, J. A. Van Strijp, E. G. Huizinga
Structural Basis For Inhibition Of Tlr2 By Staphylococcal Superantigen-Like Protein 3 (Ssl3).
Proc. Natl. Acad. Sci. Usa V. 112 11018 2015
PubMed-ID: 26283364  |  Reference-DOI: 10.1073/PNAS.1502026112

(-) Compounds

Molecule 1 - STAPHYLOCOCCAL SUPERANTIGEN-LIKE PROTEIN 3
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VariantROSETTA-GAMI
    FragmentUNP RESIDUES 164-356
    GeneSAOUHSC_00386
    Organism ScientificSTAPHYLOCOCCUS AUREUS (STRAIN NCTC 8325)
    Organism Taxid93061

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 12)

Asymmetric Unit (4, 12)
No.NameCountTypeFull Name
1CL4Ligand/IonCHLORIDE ION
2GOL5Ligand/IonGLYCEROL
3NA1Ligand/IonSODIUM ION
4SCN2Ligand/IonTHIOCYANATE ION
Biological Unit 1 (2, 4)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2GOL3Ligand/IonGLYCEROL
3NA-1Ligand/IonSODIUM ION
4SCN1Ligand/IonTHIOCYANATE ION
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2GOL2Ligand/IonGLYCEROL
3NA-1Ligand/IonSODIUM ION
4SCN1Ligand/IonTHIOCYANATE ION

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:292 , ASN A:317binding site for residue CL A 401
02AC2SOFTWAREILE A:235 , GLN A:270 , HIS A:275binding site for residue CL A 402
03AC3SOFTWARELYS A:185 , HOH A:567binding site for residue CL A 403
04AC4SOFTWAREASP A:140 , HOH A:555binding site for residue SCN A 404
05AC5SOFTWAREGLU A:205 , VAL A:216 , LYS A:303 , GLU A:306 , HOH A:504 , HOH A:506 , TYR B:209binding site for residue GOL A 405
06AC6SOFTWARELYS A:230 , GLU A:232 , GLU A:250 , ASN B:174binding site for residue GOL A 406
07AC7SOFTWAREARG A:175 , ILE B:172 , PRO B:173 , ASN B:174binding site for residue GOL A 407
08AC8SOFTWAREASN B:292 , ASN B:317binding site for residue CL B 401
09AC9SOFTWARELYS A:161 , MET B:159 , GLY B:193 , PRO B:194binding site for residue SCN B 402
10AD1SOFTWARESER B:149 , GLU B:151 , PHE B:201binding site for residue NA B 403
11AD2SOFTWARETHR B:297 , GLU B:299 , GLN B:305 , ARG B:308 , HOH B:502 , HOH B:534binding site for residue GOL B 404
12AD3SOFTWAREGLU B:151 , VAL B:200 , PHE B:201 , LYS B:255 , GLU B:262 , HOH B:514binding site for residue GOL B 405

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5D3D)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric Unit
No.Residues
1Gly A:193 -Pro A:194
2Lys B:161 -Pro B:162
3Gly B:193 -Pro B:194

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5D3D)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5D3D)

(-) Exons   (0, 0)

(no "Exon" information available for 5D3D)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:190
                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh....eeeeeeee..........eeee......eeee..hhhhhhh....eeeeeeee............ee..eee.......eeeeeeeeee.....eeeeeeeeee...eeehhhhhhhhhhhhhhhhh......eeeeeeee....eeeee.....hhhhhh.eee...eeeeeeeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d3d A 137 KYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK 326
                                   146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326

Chain B from PDB  Type:PROTEIN  Length:195
                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhh....eeeeeeee..........eeee......eeee.hhhhhhh.....eeeeeeee............ee..eee.......eeeeeeeeee.....eeeeeeeeee...eeehhhhhhhhhhhhhhhhh......eeeeeeee....eeeee.....hhhhhh.eee...eeeeeeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5d3d B 132 GSMTPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK 326
                                   141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5D3D)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5D3D)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5D3D)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SCN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:193 - Pro A:194   [ RasMol ]  
    Gly B:193 - Pro B:194   [ RasMol ]  
    Lys B:161 - Pro B:162   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5d3d
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q2G0X7_STAA8 | Q2G0X7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q2G0X7_STAA8 | Q2G0X7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q2G0X7_STAA8 | Q2G0X75d3i 5i4d

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5D3D)